| Clone Name | baala21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN646_HUMAN (O15015) Zinc finger protein 646 | 31 | 3.5 | 2 | LIN59_CAEEL (O44757) Protein lin-59 (Abnormal cell lineage prote... | 31 | 3.5 | 3 | YCF39_ODOSI (P49534) Hypothetical 36.3 kDa protein ycf39 (ORF319) | 30 | 4.6 | 4 | TECTA_CHICK (Q9YH85) Alpha-tectorin precursor | 30 | 6.0 | 5 | POLG_CXB6S (Q9QL88) Genome polyprotein [Contains: Coat protein V... | 30 | 7.9 |
|---|
>ZN646_HUMAN (O15015) Zinc finger protein 646| Length = 1829 Score = 30.8 bits (68), Expect = 3.5 Identities = 27/85 (31%), Positives = 32/85 (37%), Gaps = 18/85 (21%) Frame = +3 Query: 267 QDCGVHNEQHHSLCSH*GAEESRDF*CGAC-----------HWSHRRCRTESRRCPAEEG 413 +DCG SL +H ++ DF CGAC + R R SRR G Sbjct: 620 RDCGKSYRHSGSLINHRQTHQTGDFSCGACAKHFHTMAAMKNHLRRHSRRRSRRHRKRAG 679 Query: 414 GACPSIG*K-------CREGEDNVG 467 GA K RE EDN G Sbjct: 680 GASGGREAKLLAAESWTRELEDNEG 704
>LIN59_CAEEL (O44757) Protein lin-59 (Abnormal cell lineage protein 59)| Length = 1312 Score = 30.8 bits (68), Expect = 3.5 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -1 Query: 525 LRIECVSLCNIAY-NQVHIWPQHCPRLLCISN 433 LR++C S C++ Y + W + C LC+SN Sbjct: 613 LRVQCSSDCSVPYCSNRRFWKEDCGNKLCVSN 644
>YCF39_ODOSI (P49534) Hypothetical 36.3 kDa protein ycf39 (ORF319)| Length = 319 Score = 30.4 bits (67), Expect = 4.6 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +1 Query: 421 VRVLVRNAEKARTMLGPDVDLIIGDVTKGDTLDPKYFKGIKKVIN 555 VR LVRN KA + +LI GD+++ +T+ P +GI VI+ Sbjct: 27 VRCLVRNFRKANFLKEWGAELIYGDLSRPETI-PPCLQGITAVID 70
>TECTA_CHICK (Q9YH85) Alpha-tectorin precursor| Length = 2120 Score = 30.0 bits (66), Expect = 6.0 Identities = 23/73 (31%), Positives = 28/73 (38%), Gaps = 2/73 (2%) Frame = +3 Query: 297 HSLCSH*GAEESRDF*CGACHWSHRRCRTESRRCPAEEGGACPSIG*KCREGEDNVGARC 476 HSLC + R C W+ C E C E+GG C EGE C Sbjct: 625 HSLCRSGCVVDGRSR-CREVFWATADCTAE---CQCEDGGEAKCFNTSCPEGE-----VC 675 Query: 477 GLD--YRRCYKGR 509 ++ YR CY R Sbjct: 676 TIEDGYRGCYPKR 688
>POLG_CXB6S (Q9QL88) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2183 Score = 29.6 bits (65), Expect = 7.9 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -1 Query: 417 HPLLP-QDIDDSPSDTAGGSSDKHHIRSLCFLRRLSGSRGCDAAHYGLHNLERIRRPV 247 HP++P +DI +S T + + H+RSLC L A H G H E R V Sbjct: 2111 HPVMPMKDIHESIRWTKDPKNTQDHVRSLCLL----------AWHNGEHEYEEFIRKV 2158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,379,224 Number of Sequences: 219361 Number of extensions: 1874430 Number of successful extensions: 6213 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6209 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)