Clone Name | baak4p11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CARA_ZYMMO (O50235) Carbamoyl-phosphate synthase small chain (EC... | 28 | 4.7 |
---|
>CARA_ZYMMO (O50235) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 374 Score = 28.5 bits (62), Expect = 4.7 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +3 Query: 9 MAEXARSGAVKAGMDVRESLSPKQKGDWQDVALMSLSFAVYVYISQK 149 + E ARS A GMD+ S+S Q +WQ+ + SL V +QK Sbjct: 139 LIETARSWAGLQGMDLARSVSTHQSYNWQE-GIWSLQNGYSVVDNQK 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,631,863 Number of Sequences: 219361 Number of extensions: 310305 Number of successful extensions: 668 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)