| Clone Name | baak4p07 |
|---|---|
| Clone Library Name | barley_pub |
>CWC21_YARLI (Q6C0M9) Pre-mRNA-splicing factor CWC21| Length = 284 Score = 39.7 bits (91), Expect = 0.006 Identities = 20/42 (47%), Positives = 30/42 (71%) Frame = +3 Query: 78 EHRQKLRQIEIAVMQYRDSLEEKGLHNMEEIERKVASHRRRL 203 EH +K R++E+A M+ +D LEE+G EEIE +V + RR+L Sbjct: 71 EHERK-RKVEVACMELQDKLEEEGQKGEEEIEEEVNTLRRQL 111
>CWC21_CRYNE (Q5KDV1) Pre-mRNA-splicing factor CWC21| Length = 205 Score = 36.2 bits (82), Expect = 0.064 Identities = 18/42 (42%), Positives = 30/42 (71%) Frame = +3 Query: 78 EHRQKLRQIEIAVMQYRDSLEEKGLHNMEEIERKVASHRRRL 203 EH +K R++E+ VM+ RD LEEKG+ ++IE + + R++L Sbjct: 64 EHERK-RRVEVKVMELRDELEEKGMEE-DDIEEECSKLRQKL 103
>CWC21_ASHGO (Q751G9) Pre-mRNA-splicing factor CWC21| Length = 125 Score = 35.0 bits (79), Expect = 0.14 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = +3 Query: 96 RQIEIAVMQYRDSLEEKGLHNMEEIERKVASHRRRLQSD 212 R+IE+ V + RD LE+ + + EEIER+ RR+LQS+ Sbjct: 66 REIEVRVSELRDELEDADI-DAEEIERRCEQLRRQLQSE 103
>CWC21_YEAST (Q03375) Pre-mRNA-splicing factor CWC21 (Complexed with CEF1| protein 21) Length = 135 Score = 33.1 bits (74), Expect = 0.54 Identities = 17/46 (36%), Positives = 30/46 (65%) Frame = +3 Query: 75 EEHRQKLRQIEIAVMQYRDSLEEKGLHNMEEIERKVASHRRRLQSD 212 E H +K R+IE+ V + RD LEE+ + E+I++K + R +L ++ Sbjct: 65 ETHMEK-REIEVQVSELRDRLEEEETLSEEQIDKKCEALRAKLTNE 109
>CYSP1_DICDI (P04988) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 343 Score = 32.7 bits (73), Expect = 0.71 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%) Frame = -3 Query: 363 MTSLKDYGSCFGCEAVSWKNHVHHPPFLSAPMIVS---QKTVCCLHRLLKTNHDQI--EG 199 +T +K+ G C C + S +V F+S +VS Q V C H ++ ++ EG Sbjct: 130 VTPVKNQGQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEYEGEEACDEG 189 Query: 198 AYGGWQPSS 172 GG QP++ Sbjct: 190 CNGGLQPNA 198
>APOD_CAVPO (P51909) Apolipoprotein D precursor (Apo-D) (ApoD)| Length = 189 Score = 30.4 bits (67), Expect = 3.5 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -3 Query: 360 TSLKDYGSCFGCEAVSWKNHVHHPPFLSAPMIVSQKTVCCLHRLLKTNHDQIE 202 T +Y + C + W HV H L + Q+TV L +L +N+ IE Sbjct: 123 TDYDNYALVYSCTNIIWLFHVDHIWILGRNRYLPQETVTYLKDILTSNNIDIE 175
>PCNT_HUMAN (O95613) Pericentrin (Pericentrin B) (Kendrin)| Length = 3336 Score = 30.0 bits (66), Expect = 4.6 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = +3 Query: 36 TDQAIHHPDTIVNEEHRQKLRQIEIAVMQYRDSLE---EKGLHNMEEIERKVASHRRRLQ 206 T +A H DT + QKL++ + V+ + LE ++ LH+ +++E + H L+ Sbjct: 2775 TQEACVHQDTQAHHALLQKLKEEKSRVVDLQAMLEKVQQQALHSQQQLEAEAQKHCEALR 2834 Query: 207 SDHGLSS 227 + +S+ Sbjct: 2835 REKEVSA 2841
>POL_IPMA (P11368) Putative Pol polyprotein [Contains: Integrase (IN);| Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT)] Length = 867 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 324 EAVSWKNHVHHPPFLSAPMIVSQKTVCCLHRLLKTNH 214 E V WKN +H+ + P+++ + C+ +KT H Sbjct: 807 EMVKWKNVLHNKWYGPDPILIRSRGAVCVFHRMKTTH 843
>AGUA_ERWCT (Q6CZ80) Putative agmatine deiminase (EC 3.5.3.12) (Agmatine| iminohydrolase) Length = 368 Score = 30.0 bits (66), Expect = 4.6 Identities = 26/105 (24%), Positives = 43/105 (40%), Gaps = 5/105 (4%) Frame = +1 Query: 250 GLLRDYHWSGKKGRMMHVILPGNGLAAEAGAVVLQGSHHWIEIESTVAAEADCMAMTPGE 429 GL D+ K +L + A A ++L+G ++ E T+ A+C+ + P Sbjct: 128 GLYEDWRQDEKVAAQ---VLDYHQAAGYAAPLILEGGSIHVDGEGTLLTTAECL-LNPNR 183 Query: 430 TGHVKKAQAEGRM-----ITTIGAAETGKRTGERGR*LKPCCALI 549 H+ KA+ E M I+TI E G E + C + Sbjct: 184 NPHLSKAEIEQLMRDYLSISTIIWLEEGVYNDETDGHIDNMCCFV 228
>AGUA_SELRU (Q5KR05) Putative agmatine deiminase (EC 3.5.3.12) (Agmatine| iminohydrolase) Length = 371 Score = 30.0 bits (66), Expect = 4.6 Identities = 24/80 (30%), Positives = 36/80 (45%) Frame = +1 Query: 247 DGLLRDYHWSGKKGRMMHVILPGNGLAAEAGAVVLQGSHHWIEIESTVAAEADCMAMTPG 426 DGL DY M L G+ L +AG VL+G ++ E TV C+ ++ G Sbjct: 126 DGLYPDYGQDDAAAEKMCAAL-GDELY-DAGDFVLEGGSIHVDGEGTVVVTEACL-LSQG 182 Query: 427 ETGHVKKAQAEGRMITTIGA 486 + K Q E ++ +GA Sbjct: 183 RNPDLSKEQIEAMLLKYLGA 202
>ATPB_BACP3 (P07677) ATP synthase beta chain (EC 3.6.3.14)| Length = 473 Score = 29.6 bits (65), Expect = 6.0 Identities = 20/62 (32%), Positives = 36/62 (58%), Gaps = 3/62 (4%) Frame = +3 Query: 30 ISTDQAIHHPDTIVNEEHRQKLRQIEIAVMQYRDSLEEKGLHNMEEI--ERKVASHR-RR 200 +ST +A+ IV EEH Q R+++ + +Y++ + + M+E+ E K+ HR RR Sbjct: 348 VSTSRAL--APEIVGEEHYQVARKVQQTLERYKELQDIIAILGMDELSDEDKLVVHRARR 405 Query: 201 LQ 206 +Q Sbjct: 406 IQ 407
>US15_HCMVA (P09718) Hypothetical protein HVLF3| Length = 262 Score = 29.3 bits (64), Expect = 7.8 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = -3 Query: 480 YRGDHPS-LGLSFF----HVPCLSRRHCHAICLCCDCTLYLYPVMTSLKDYGSCFG 328 Y HPS +G+ F HVP L ICLC D TL + + +L + SC G Sbjct: 100 YETSHPSNIGVLLFYTLLHVPPLI-----VICLCLDGTLVISAALFTLLAFLSCTG 150
>ATPB_GEOTH (Q9LA80) ATP synthase beta chain (EC 3.6.3.14)| Length = 473 Score = 29.3 bits (64), Expect = 7.8 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = +3 Query: 66 IVNEEHRQKLRQIEIAVMQYRDSLEEKGLHNMEEI--ERKVASHR-RRLQ 206 IV EEH Q R+++ + +Y++ + + M+E+ E K+ HR RR+Q Sbjct: 358 IVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQ 407
>ATPB_BACST (P42006) ATP synthase beta chain (EC 3.6.3.14)| Length = 473 Score = 29.3 bits (64), Expect = 7.8 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = +3 Query: 66 IVNEEHRQKLRQIEIAVMQYRDSLEEKGLHNMEEI--ERKVASHR-RRLQ 206 IV EEH Q R+++ + +Y++ + + M+E+ E K+ HR RR+Q Sbjct: 358 IVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQ 407
>ATPB_BACCA (P41009) ATP synthase beta chain (EC 3.6.3.14)| Length = 473 Score = 29.3 bits (64), Expect = 7.8 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = +3 Query: 66 IVNEEHRQKLRQIEIAVMQYRDSLEEKGLHNMEEI--ERKVASHR-RRLQ 206 IV EEH Q R+++ + +Y++ + + M+E+ E K+ HR RR+Q Sbjct: 358 IVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQ 407 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,169,996 Number of Sequences: 219361 Number of extensions: 1168802 Number of successful extensions: 4482 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 4292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4481 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)