Clone Name | baak4p06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y498_BUCBP (Q89A47) Hypothetical protein bbp_498 | 29 | 2.9 | 2 | NPY1R_XENLA (P34992) Neuropeptide Y receptor type 1 (NPY1-R) | 28 | 8.5 | 3 | RGYR2_AQUAE (O67226) Reverse gyrase 2 [Includes: Helicase (EC 3.... | 28 | 8.5 |
---|
>Y498_BUCBP (Q89A47) Hypothetical protein bbp_498| Length = 374 Score = 29.3 bits (64), Expect = 2.9 Identities = 10/44 (22%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +3 Query: 15 CNIQLVWRQFPVGNYVCWQ-----FPVETFSVTLFVCLESIHFW 131 CN+ ++W+ F G + + + + ++S T + CL ++++W Sbjct: 209 CNLNIIWKIFLQGEKLLKKSGYKKYEISSYSKTNYQCLHNLNYW 252
>NPY1R_XENLA (P34992) Neuropeptide Y receptor type 1 (NPY1-R)| Length = 366 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 48 VGNYVCWQ-FPVETFSVTLFVCLESIHFWPPVIIVHVCRYKI*LQ 179 +G YVC + FP + F ++ L + + P+ + VC KI L+ Sbjct: 188 IGKYVCLEDFPEDKFRLSYTTLLFILQYLGPLCFIFVCYTKIFLR 232
>RGYR2_AQUAE (O67226) Reverse gyrase 2 [Includes: Helicase (EC 3.6.1.-);| Topoisomerase (EC 5.99.1.3)] Length = 1159 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -1 Query: 107 DKQSHAKSFYRELPAYVVSYRELSPYELY 21 DK K FYR+ VSY + P ELY Sbjct: 324 DKVQEVKEFYRKHGINAVSYLDYKPEELY 352 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,939,629 Number of Sequences: 219361 Number of extensions: 506494 Number of successful extensions: 1413 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1413 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)