| Clone Name | baak4o14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZBT38_RAT (Q5EXX3) Zinc finger and BTB domain-containing protein... | 31 | 0.80 | 2 | NCOR1_XENLA (Q8QG78) Nuclear receptor corepressor 1 (N-CoR1) (N-... | 29 | 3.0 | 3 | Y287_MYCLE (O69601) Hypothetical protein ML0287 | 28 | 4.0 | 4 | Y4QG_RHISN (P55628) Probable aminotransferase y4qG (EC 2.6.1.-) | 28 | 6.8 | 5 | VF12_VACCP (P29889) Protein F12 (Protein F6) | 27 | 8.8 |
|---|
>ZBT38_RAT (Q5EXX3) Zinc finger and BTB domain-containing protein 38 (Zinc| finger protein expressed in neurons) (Zenon) Length = 1203 Score = 30.8 bits (68), Expect = 0.80 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -2 Query: 239 PS*HHITRVNSQLTNKANVLDLTATKAGPTRRPRTMTHGPRTTTSIVP-EVSPCPQ 75 P H + +S T K N LT TKA P R+P+T T +TT +P + CP+ Sbjct: 236 PLREHDSSSSSGKTGKENGEALT-TKAKPCRKPKTQTQDSDSTTENMPLPLVTCPE 290
>NCOR1_XENLA (Q8QG78) Nuclear receptor corepressor 1 (N-CoR1) (N-CoR) (xN-CoR)| Length = 2498 Score = 28.9 bits (63), Expect = 3.0 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = -2 Query: 212 NSQLTNKANVLDLTATKAGPTRRPRTMTHGPRTTTSIVPEVSPCPQEKP 66 N+Q K V A++A T T P TTTS V+P P P Sbjct: 568 NNQGRRKGRVTRSMASEAAAANAVTTATTAPVTTTSTATTVAPVPVAPP 616
>Y287_MYCLE (O69601) Hypothetical protein ML0287| Length = 222 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 11/51 (21%) Frame = +1 Query: 70 FSCGQGETSGTMEVVVLGPWVIV-----------LGRRVGPALVAVRSRTF 189 F+ G T GT+++ VL P V V +GRR+GPAL + F Sbjct: 54 FTGGLLATKGTIDIWVLSPSVAVVAVLGDQIGYLIGRRIGPALFKKENSRF 104
>Y4QG_RHISN (P55628) Probable aminotransferase y4qG (EC 2.6.1.-)| Length = 448 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 9/53 (16%) Frame = +1 Query: 22 RKRRLHFARRVCTSHGF---------SCGQGETSGTMEVVVLGPWVIVLGRRV 153 RK L +R+C SHG CG+ + E L P V+VL + + Sbjct: 247 RKEWLQSIQRICRSHGILLIVDDIQAGCGRAGNFFSFEFAGLSPDVVVLSKSI 299
>VF12_VACCP (P29889) Protein F12 (Protein F6)| Length = 635 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = -2 Query: 215 VNSQLTNK---ANVLDLTATKAGPTRRPRTMTHGPR 117 VN+Q +NK +VLD+ ++K P RRP + +G + Sbjct: 443 VNNQESNKYRIKSVLDIISSKQYPARRPNYVKNGTK 478 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,964,789 Number of Sequences: 219361 Number of extensions: 1070789 Number of successful extensions: 2456 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2455 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)