Clone Name | baak4o06 |
---|---|
Clone Library Name | barley_pub |
>CWF16_SCHPO (Q9P7C5) Cell cycle control protein cwf16| Length = 270 Score = 30.4 bits (67), Expect = 2.6 Identities = 12/47 (25%), Positives = 20/47 (42%) Frame = +3 Query: 126 QRRGDHYQLVDVIRFYVDCPDCSAT*CVKRGPXXXXXXXXXXXXNNY 266 ++ G+ Y +D++RFY+ C C+A P NY Sbjct: 66 EKTGEKYFSIDILRFYIRCTRCAAEITFITDPKHADYAAESGASRNY 112
>UT14A_MOUSE (Q640M1) U3 small nucleolar RNA-associated protein 14 homolog A| (Juvenile spermatogonial depletion-like X-linked protein) (Jsd-like X-linked protein) Length = 767 Score = 30.0 bits (66), Expect = 3.3 Identities = 20/80 (25%), Positives = 33/80 (41%) Frame = +1 Query: 223 KNKNEICNDANKITTNDEEGFIDCDDVGADENEDAENAKTNGCK*WKLKYIWNLPKENRI 402 KNK E+ ++ ++EEG D ++ + + +G W L+ KEN I Sbjct: 329 KNK-ELTQKLQVVSESEEEGGADEEEALVPDIVNEVQKTADGPNPWMLRSCSRDAKENEI 387 Query: 403 MVRSNDLPNIFLHTRPRKQQ 462 S LP H P ++ Sbjct: 388 QADSEQLPESAAHEFPENEE 407
>HS90A_BRARE (Q90474) Heat shock protein HSP 90-alpha| Length = 726 Score = 29.6 bits (65), Expect = 4.4 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 217 GQKNKNEICNDANKITTNDEEGFIDCDDVGADENEDAENAKTNGCK*WKLKYI--WNLPK 390 G+K + E ++ +++ +D+GADE+ED+++ K K K KYI L K Sbjct: 233 GEKQEEE------EVAAGEDKDKPKIEDLGADEDEDSKDGKNKRKKKVKEKYIDAQELNK 286 Query: 391 ENRIMVRSND 420 I R+ D Sbjct: 287 TKPIWTRNPD 296
>SIS2_YEAST (P36024) Protein SIS2 (Halotolerance protein HAL3)| Length = 562 Score = 29.6 bits (65), Expect = 4.4 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +1 Query: 223 KNKNEICNDANKITTNDEEGFIDCDDVGADENEDAENAKTNG 348 ++KNE ND + +D++ D DD D++ED + A+T G Sbjct: 515 EDKNENNNDDDDDDDDDDDDDDDDDDDDDDDDEDEDEAETPG 556
>S6A18_HUMAN (Q96N87) Sodium- and chloride-dependent transporter XTRP2 (Solute| carrier family 6 member 18) Length = 628 Score = 29.3 bits (64), Expect = 5.7 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -3 Query: 276 FIISSYFVGVITYLVFVFLAPFSH-IMWPSSQDSLHRTG 163 F+IS Y+ ++ ++++ L F H + W S L+RTG Sbjct: 109 FLISLYYNTIVAWVLWYLLNSFQHPLPWSSCPPDLNRTG 147
>PHSG_SHIFL (P0AC87) Glycogen phosphorylase (EC 2.4.1.1)| Length = 815 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 135 GDHYQLVDVIRFYVDCPD 188 GDHYQ++ R YVDC D Sbjct: 751 GDHYQVLADYRSYVDCQD 768
>PHSG_ECOLI (P0AC86) Glycogen phosphorylase (EC 2.4.1.1)| Length = 815 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 135 GDHYQLVDVIRFYVDCPD 188 GDHYQ++ R YVDC D Sbjct: 751 GDHYQVLADYRSYVDCQD 768
>DCR1C_CHICK (Q5QJC2) Artemis protein (EC 3.1.-.-) (DNA cross-link repair 1C| protein) (chSNM1C) (SNM1-like protein) Length = 714 Score = 28.5 bits (62), Expect = 9.7 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 2/83 (2%) Frame = +1 Query: 187 TARPHNV*KGGQKNKNEICND--ANKITTNDEEGFIDCDDVGADENEDAENAKTNGCK*W 360 TA+P N ++N NE AN T+ + F+DC++ D+++D ++ K + + Sbjct: 416 TAQPENA----ERNINESTESYRANTAYTSLKVDFVDCEESNDDDDDDDDDDKEDDSEKN 471 Query: 361 KLKYIWNLPKENRIMVRSNDLPN 429 + + + P N I N +P+ Sbjct: 472 TAQVLSHEPDANSI-ASCNGIPS 493 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,067,183 Number of Sequences: 219361 Number of extensions: 981184 Number of successful extensions: 3601 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3599 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)