Clone Name | baak4m22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SSPO_BOVIN (P98167) SCO-spondin (Fragment) | 29 | 5.8 | 2 | NUPL2_CHICK (Q5ZI22) Nucleoporin-like 2 | 29 | 7.6 | 3 | CAR15_MOUSE (Q8K3Z0) Caspase recruitment domain-containing prote... | 29 | 7.6 |
---|
>SSPO_BOVIN (P98167) SCO-spondin (Fragment)| Length = 867 Score = 29.3 bits (64), Expect = 5.8 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = -1 Query: 153 EGRPNAVEPRMICLQATRWSQSRPWPALDLGACVYPPSSHALRSSQQPSAA 1 +GRP +P + C WS PW A LG C + RS P A Sbjct: 173 DGRPRRCQPSLDCAVNCGWSAWSPW-AECLGPCGSRSVQWSFRSPNNPRPA 222
>NUPL2_CHICK (Q5ZI22) Nucleoporin-like 2| Length = 413 Score = 28.9 bits (63), Expect = 7.6 Identities = 19/66 (28%), Positives = 28/66 (42%) Frame = +3 Query: 27 SRHDLRGGIRRHPDQELAMAGSGSIWLPAGKSFLALLHWGVLPYHTTFFPENSGAGFQGC 206 + H GG R H + AG G W A + + ++ + H+T+ G GF G Sbjct: 20 NEHPRGGGGRPHSAGPVRGAGGG--WGAASQRYANVIQPPIFK-HSTWGGSGDGGGFSGA 76 Query: 207 CDGGDP 224 D G P Sbjct: 77 SDFGSP 82
>CAR15_MOUSE (Q8K3Z0) Caspase recruitment domain-containing protein 15 (Nod2| protein) Length = 1020 Score = 28.9 bits (63), Expect = 7.6 Identities = 21/63 (33%), Positives = 28/63 (44%) Frame = +2 Query: 104 VACRQIILGSTALGRPSISHYLLP*KFRCWFSGML*WWGSPYACKKVSEALAVYHGYELY 283 V R+ G + G+P +SH W G+ WG + V EA A H +ELY Sbjct: 45 VLSREDYEGLSLPGQP-LSHSARRLLDTVWNKGV---WGCQKLLEAVQEAQANSHTFELY 100 Query: 284 GLW 292 G W Sbjct: 101 GSW 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,907,071 Number of Sequences: 219361 Number of extensions: 1942630 Number of successful extensions: 4569 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4566 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)