Clone Name | baak4l09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LIPB_PROMA (Q7VDH8) Lipoyltransferase (EC 2.3.1.-) (Lipoyl-[acyl... | 30 | 4.6 | 2 | P53_MOUSE (P02340) Cellular tumor antigen p53 (Tumor suppressor ... | 30 | 7.9 |
---|
>LIPB_PROMA (Q7VDH8) Lipoyltransferase (EC 2.3.1.-) (Lipoyl-[acyl-carrier| protein]-protein-N-lipoyltransferase) (Lipoate-protein ligase B) Length = 224 Score = 30.4 bits (67), Expect = 4.6 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = +1 Query: 415 WCHAKLQLMIGHSAETWQASN*MTEKLCVSMDGLNQFVEIHHRPYRVHQTNTW 573 WC+ K IG S W + + + + G NQ V + Y+ + N+W Sbjct: 146 WCNGKKVASIGISCRRWITQHGIALNVDCDLLGFNQIVPCGLKDYQTGRLNSW 198
>P53_MOUSE (P02340) Cellular tumor antigen p53 (Tumor suppressor p53)| Length = 390 Score = 29.6 bits (65), Expect = 7.9 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -1 Query: 496 KAFLSFSYLLAMFQLNDRSSTVVSHDTIGHSVFCMVKFNQSVSNHK 359 K F F L +L D +T S D+ HS + K QS S HK Sbjct: 333 KRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHK 378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,687,986 Number of Sequences: 219361 Number of extensions: 1487078 Number of successful extensions: 3036 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2981 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3036 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)