| Clone Name | baak4k17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ADA1A_BOVIN (P18130) Alpha-1A adrenergic receptor (Alpha 1A-adre... | 31 | 3.5 | 2 | TRPA_METCA (Q604P4) Tryptophan synthase alpha chain (EC 4.2.1.20) | 30 | 4.5 | 3 | U171_DROME (Q9VUB4) Hypothetical UPF0171 protein CG8783 | 30 | 5.9 | 4 | M3K12_MOUSE (Q60700) Mitogen-activated protein kinase kinase kin... | 30 | 7.7 |
|---|
>ADA1A_BOVIN (P18130) Alpha-1A adrenergic receptor (Alpha 1A-adrenoceptor)| (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) Length = 466 Score = 30.8 bits (68), Expect = 3.5 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +2 Query: 485 DQILWFNNFRHAARSSARVHPCVTPGSCRTIGIRSHMFLVVACKFGVS 628 D + + F R SAR+ P +C T +RS FL V C G S Sbjct: 392 DGVCEWKIFSSLPRGSARMAVARDPSACTTARVRSKSFLQVCCCLGPS 439
>TRPA_METCA (Q604P4) Tryptophan synthase alpha chain (EC 4.2.1.20)| Length = 267 Score = 30.4 bits (67), Expect = 4.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 498 GSTTSDMPPVVVREFIPVLHQGVVEP 575 G T DMPP EF+P+LH+ ++P Sbjct: 125 GVLTVDMPPEEAGEFVPMLHRAGLDP 150
>U171_DROME (Q9VUB4) Hypothetical UPF0171 protein CG8783| Length = 610 Score = 30.0 bits (66), Expect = 5.9 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = -3 Query: 384 VWLISY-LLLVVQNQVGMLQT-DELNQNLSLKHQAGQKVPSEVTDH-PKFEFLHGDMVRI 214 +W++ + LL+ + V + + DE + S + + E D P + LHG M+ + Sbjct: 398 IWMLQHHLLMQLHTYVQFMPSEDEFGDSASCSNHLRDAISDEEGDQEPDADELHGSMLSM 457 Query: 213 LHHPYLTPTLLADHKKR 163 HP P +L +R Sbjct: 458 SSHPLPVPAVLVGGHRR 474
>M3K12_MOUSE (Q60700) Mitogen-activated protein kinase kinase kinase 12 (EC| 2.7.11.25) (Mixed lineage kinase) (Leucine-zipper protein kinase) (ZPK) (Dual leucine zipper bearing kinase) (DLK) (MAPK-upstream kinase) (MUK) Length = 888 Score = 29.6 bits (65), Expect = 7.7 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = -3 Query: 336 MLQTDELNQNLSLKHQA-GQKVPSEVTDHPKFEFLHGDMVRILHHPYLTPTLLADHKKRR 160 MLQ + + L + QA ++ P + HP LHG+ + L P L+ H KR Sbjct: 480 MLQLELKERELLRREQALERRCPGLLKSHPSRGLLHGNTMEKLIKKRNVPQKLSPHSKRP 539 Query: 159 H*LQEQSQL 133 L+ +S L Sbjct: 540 DILKTESLL 548 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,060,545 Number of Sequences: 219361 Number of extensions: 1886611 Number of successful extensions: 4569 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4569 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)