| Clone Name | baak4k16 |
|---|---|
| Clone Library Name | barley_pub |
>ROA1_DROME (P07909) Heterogeneous nuclear ribonucleoprotein A1 (hnRNP core| protein A1-A) (PEN repeat clone P9) Length = 365 Score = 33.1 bits (74), Expect = 0.52 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 5 WLGSSKTSGGDDQAGKRDGNNSWSQNKP-SSGNGSSILGQWG 127 W +S GG G GNNSW N P +GNG G G Sbjct: 256 WGNNSFGGGGGGGGGYGGGNNSWGNNNPWDNGNGGGNFGGGG 297
>EPSP2_RALSO (Q45408) Probable low molecular weight protein-tyrosine-phosphatase| epsP (EC 3.1.3.48) Length = 145 Score = 30.8 bits (68), Expect = 2.6 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 430 RQNQAQLILEQALPPTTTITAGVPALAAVPS 338 R AQ +L QALP + I+AG+ AL+ P+ Sbjct: 15 RSPMAQALLRQALPGVSVISAGIGALSGYPA 45
>HYR1_CANAL (P46591) Hyphally-regulated protein precursor| Length = 937 Score = 30.4 bits (67), Expect = 3.4 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 11 GSSKTSGGDDQAGKRDGNNSWSQ--NKPSSGNGSS 109 GS SG Q+G G+NS S + P +GNGS+ Sbjct: 716 GSQSGSGSGSQSGSESGSNSGSNEGSNPGAGNGSN 750
>EPSP1_RALSO (P58596) Probable low molecular weight protein-tyrosine-phosphatase| epsP (EC 3.1.3.48) Length = 145 Score = 29.6 bits (65), Expect = 5.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 430 RQNQAQLILEQALPPTTTITAGVPALAAVPS 338 R AQ +L Q+LP + I+AG+ AL+ P+ Sbjct: 15 RSPMAQALLRQSLPGVSVISAGIGALSGYPA 45
>IF2_BIFLO (Q8G3Y5) Translation initiation factor IF-2| Length = 954 Score = 29.6 bits (65), Expect = 5.8 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 29 GGDDQAGKRDGNNSWSQNKPSSGNGSSILGQWGA 130 G Q G R G W N+P G GS GQ GA Sbjct: 246 GQGGQGGPRPGQ--WGHNRPGQGGGSQGAGQGGA 277
>IL2RB_MACFA (Q38J85) Interleukin-2 receptor beta chain precursor (IL-2| receptor) (P70-75) (High affinity IL-2 receptor beta subunit) (CD122 antigen) Length = 551 Score = 29.6 bits (65), Expect = 5.8 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 Query: 440 WLVPLAMLAEPLYTSSASKTFRGTS 514 W +PL +L PL TSSAS GTS Sbjct: 8 WCLPLLILLLPLATSSASAAVNGTS 32
>AGOG_METKA (Q8TXW8) N-glycosylase/DNA lyase (AGOG) (8-oxoguanine DNA| glycosylase) (EC 3.2.2.-) (DNA-(apurinic or apyrimidinic site) lyase) (EC 4.2.99.18) (AP lyase) Length = 242 Score = 29.3 bits (64), Expect = 7.6 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = +1 Query: 118 SVGCSSWQHYSWYFRIRRWRRIMGKEQ*RYLEFVKRNRRLRR 243 S G W+ +S YFR RR R I+ +E R+L + NRRL R Sbjct: 57 SSGEDWWREFSSYFRERRPRDIV-REYARFLPRSRGNRRLIR 97
>NALP1_HUMAN (Q9C000) NACHT-, LRR- and PYD-containing protein 2 (Death effector| filament-forming ced-4-like apoptosis protein) (Nucleotide-binding domain and caspase recruitment domain) (Caspase recruitment domain protein 7) Length = 1473 Score = 29.3 bits (64), Expect = 7.6 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 62 NNSWSQNKPSSGNGSSILGQWGAPP 136 + S SQ P++ +++LG WG+PP Sbjct: 166 HESPSQESPNAPTSTAVLGSWGSPP 190
>CCN1E_BRARE (P47794) G1/S-specific cyclin-E| Length = 410 Score = 28.9 bits (63), Expect = 9.9 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 416 CLILACT*WLVPLAMLAEPLYTSSASKTFRGTSSD 520 C + C W+VP AM SSA KTF+G ++D Sbjct: 324 CDLEECVRWMVPFAMSIREA-GSSALKTFKGIAAD 357 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,991,822 Number of Sequences: 219361 Number of extensions: 1230093 Number of successful extensions: 3720 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3717 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)