| Clone Name | baak4k12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GEF1_SCHPO (Q09763) Rho guanine nucleotide exchange factor gef1 | 28 | 4.5 | 2 | SMP1_MAGPO (Q9Y778) Subtilisin-like proteinase Mp1 precursor (EC... | 28 | 4.5 | 3 | SPAG1_MOUSE (Q80ZX8) Sperm-associated antigen 1 (Infertility-rel... | 28 | 5.9 | 4 | RBN_IDILO (Q5QV33) tRNA-processing ribonuclease BN (EC 3.1.-.-) ... | 28 | 5.9 |
|---|
>GEF1_SCHPO (Q09763) Rho guanine nucleotide exchange factor gef1| Length = 753 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +3 Query: 15 GIIYLESLQKVTLIYSSHCSSCAGVTETVAVLRKEAAS 128 G+I+LESL ++ IY+ +C+ V + + R++ A+ Sbjct: 398 GLIFLESLSEIGQIYTGYCNRQDSVFKIITKWREKPAT 435
>SMP1_MAGPO (Q9Y778) Subtilisin-like proteinase Mp1 precursor (EC 3.4.21.-)| Length = 404 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 204 SFHQHLRWTGKSHRRH*QKEQS 139 SFH HL W G HRR K + Sbjct: 46 SFHNHLSWVGDVHRRSVSKRDT 67
>SPAG1_MOUSE (Q80ZX8) Sperm-associated antigen 1 (Infertility-related sperm| protein Spag-1) (TPR-containing protein involved in spermatogenesis) (TPIS) Length = 901 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +2 Query: 77 LCWCHRDSCCLEEGSCQPC*SDCS 148 + + +R +C L+EG+C+ C DC+ Sbjct: 473 ILYSNRAACYLKEGNCRDCIQDCN 496
>RBN_IDILO (Q5QV33) tRNA-processing ribonuclease BN (EC 3.1.-.-) (RNase BN)| Length = 284 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -3 Query: 217 LVVVIFPSTLEMDGKISSSPLTERTIRLAWLAASFLKTATVSVTPAQLEQCE 62 L + FP+ + G +++ P+ I L+WL TVS+ QL+Q E Sbjct: 229 LYITFFPTYQAIYGALATIPILIVWIYLSWLIVLIGAVLTVSLEEYQLQQPE 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,731,867 Number of Sequences: 219361 Number of extensions: 703688 Number of successful extensions: 1874 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1767 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1872 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)