Clone Name | baak4k07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ADA21_MOUSE (Q9JI76) ADAM 21 precursor (EC 3.4.24.-) (A disinteg... | 28 | 6.2 | 2 | K1H8_HUMAN (O76015) Keratin, type I cuticular Ha8 (Hair keratin,... | 28 | 6.2 | 3 | SYL_PARUW (Q6MCC8) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine-... | 28 | 8.1 |
---|
>ADA21_MOUSE (Q9JI76) ADAM 21 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 21) (ADAM 31) Length = 729 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 229 FRGAFYKDGMAPALMQVRCVHKGPRSGCGYMV 134 F Y D M L Q C++ PR G G++V Sbjct: 379 FTNCSYSDFMKTTLNQGTCLYNHPRPGAGFLV 410
>K1H8_HUMAN (O76015) Keratin, type I cuticular Ha8 (Hair keratin, type I Ha8)| Length = 456 Score = 28.1 bits (61), Expect = 6.2 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +1 Query: 70 IDRRSCMHRACIIVSYRSTTIIPCNRNLIEGLYVRT*PASEQVPCHPCKTPP 225 ++R++ ++ + V R I RNL+E ++PC+PC TPP Sbjct: 380 LERQNQEYQVLLDVKTRLENEIATYRNLLES-------EDCKLPCNPCSTPP 424
>SYL_PARUW (Q6MCC8) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 845 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 206 WHGTCSDAGQVRT*RPSIRLRLHGMIVVDRYDTMM 102 WH D G V T P LR G++V Y M Sbjct: 558 WHKVLYDCGYVHTLEPFQTLRNQGLVVARSYQNKM 592 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,328,825 Number of Sequences: 219361 Number of extensions: 480418 Number of successful extensions: 1898 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1896 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)