Clone Name | baak4i21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YN8H_YEAST (P53729) Hypothetical 48.1 kDa protein in SEC12-SSK2 ... | 29 | 8.9 |
---|
>YN8H_YEAST (P53729) Hypothetical 48.1 kDa protein in SEC12-SSK2 intergenic| region Length = 429 Score = 28.9 bits (63), Expect = 8.9 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +1 Query: 169 VTIEGQ---AYTVSAVTHRYQLRKGRYEPSEKRLDVLSTGRYILNLYLDSLLDKS 324 + IEG+ A + V Y + G+Y+ S K ++ G+Y+ ++ LL K+ Sbjct: 373 ILIEGENPIARVIQGVRDTYDVFPGKYDGSNKECKIVLIGKYLEKESIEELLRKT 427 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,450,596 Number of Sequences: 219361 Number of extensions: 767028 Number of successful extensions: 2711 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2706 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)