Clone Name | baak4i13 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SHH_CHICK (Q91035) Sonic hedgehog protein precursor (SHH) [Conta... | 30 | 4.9 | 2 | SYW_RABIT (P23612) Tryptophanyl-tRNA synthetase (EC 6.1.1.2) (Tr... | 29 | 8.3 |
---|
>SHH_CHICK (Q91035) Sonic hedgehog protein precursor (SHH) [Contains: Sonic| hedgehog protein N-product; Sonic hedgehog protein C-product] Length = 425 Score = 29.6 bits (65), Expect = 4.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 14 ACVCDDGANTLRCGDARSLHWKRQKLYKIGSTV 112 A +C DGA +HW + LY+IGS V Sbjct: 377 AALCPDGAIPTAATTTTGIHWYSRLLYRIGSWV 409
>SYW_RABIT (P23612) Tryptophanyl-tRNA synthetase (EC 6.1.1.2)| (Tryptophan--tRNA ligase) (TrpRS) Length = 475 Score = 28.9 bits (63), Expect = 8.3 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -2 Query: 336 EAYKPKCPLGGSTP-SRGNPPSLLDEPD 256 E YK CP G STP S G+P ++ D+ D Sbjct: 60 EDYKADCPPGNSTPDSHGDPEAVDDKED 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,354,956 Number of Sequences: 219361 Number of extensions: 1497673 Number of successful extensions: 2973 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2972 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)