Clone Name | baak4h23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ARR10_ARATH (O49397) Two-component response regulator ARR10 (Rec... | 30 | 1.3 |
---|
>ARR10_ARATH (O49397) Two-component response regulator ARR10 (Receiver-like| protein 4) Length = 552 Score = 30.4 bits (67), Expect = 1.3 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -2 Query: 164 IESLQINGWINRSCPPYADQNTSNLRAEFKIVLATSNRSNKNL 36 +E LQIN INR+ P + Q S + A ++L N + +L Sbjct: 334 LEELQINNNINRAFPSFTSQQNSPMVAPSNLLLLEGNPQSSSL 376 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,215,639 Number of Sequences: 219361 Number of extensions: 273304 Number of successful extensions: 468 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)