Clone Name | baak4h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YATE_SCHPO (Q09779) Hypothetical protein C1D4.14 in chromosome I | 29 | 7.0 |
---|
>YATE_SCHPO (Q09779) Hypothetical protein C1D4.14 in chromosome I| Length = 1628 Score = 29.3 bits (64), Expect = 7.0 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -2 Query: 383 SRT*RREPREGKDLTNEPMKARLRSFSTKNGWWVQNGSLNPTP 255 SR RREP++ ++L AR S K+ W QNG++N P Sbjct: 1446 SRHTRREPQQAQNLN-----ARREHESQKSDRWRQNGNVNRNP 1483 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,191,181 Number of Sequences: 219361 Number of extensions: 1156264 Number of successful extensions: 3278 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3278 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)