| Clone Name | baak4c17 |
|---|---|
| Clone Library Name | barley_pub |
>UCRQ_SOLTU (P46269) Ubiquinol-cytochrome c reductase complex| ubiquinone-binding protein QP-C (EC 1.10.2.2) (Ubiquinol-cytochrome c reductase complex 8.2 kDa protein) Length = 71 Score = 118 bits (295), Expect = 1e-26 Identities = 51/71 (71%), Positives = 62/71 (87%) Frame = +3 Query: 96 GKMPVRMKAVVYALSPFQQQVMPGLWKDITTKIHHKVSENWISATLLITPVVGTYQYAMY 275 GK PV++KAVVYA+SPFQQ++MPGLWKD+ KIHHKVSENWISATLL+ P+VGTY Y + Sbjct: 1 GKQPVKLKAVVYAISPFQQKIMPGLWKDLPGKIHHKVSENWISATLLLGPLVGTYSYVQH 60 Query: 276 YKEQEKLSHRY 308 + E+EKL HRY Sbjct: 61 FLEKEKLEHRY 71
>POLG_DEN2T (P27914) Genome polyprotein [Contains: Major envelope protein E;| Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS3 catalytic subunit (EC 3.4.21.91)] (Fragments) Length = 1683 Score = 30.4 bits (67), Expect = 3.5 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 168 LWKDITTKIHHKVSENWISATLLITPVVGTYQ 263 +WK IT++++H +SEN + T++ + G Q Sbjct: 562 MWKQITSELNHILSENEVKLTIMTGDIKGIMQ 593
>POLG_DEN2P (P12823) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3388 Score = 30.4 bits (67), Expect = 3.5 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 168 LWKDITTKIHHKVSENWISATLLITPVVGTYQ 263 +WK IT++++H +SEN + T++ + G Q Sbjct: 842 MWKQITSELNHILSENEVKLTIMTGDIKGIMQ 873
>UCRQ_SCHPO (P50523) Ubiquinol-cytochrome c reductase complex| ubiquinone-binding protein QP-C (EC 1.10.2.2) (Ubiquinol-cytochrome c reductase complex 11 kDa protein) (Complex III subunit VIII) Length = 92 Score = 30.0 bits (66), Expect = 4.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 105 PVRMKAVVYALSPFQQQVMPGLWKDITTKIHHKV 206 P + + Y+LSPFQQ+ M G +K T + +V Sbjct: 20 PKQKGIITYSLSPFQQRPMAGFFKTSTQNMFRRV 53
>POLG_DEN1S (P33478) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3396 Score = 30.0 bits (66), Expect = 4.5 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +3 Query: 168 LWKDITTKIHHKVSENWISATLLITPVVGTYQYAMYYKEQEKLSHRY 308 +WK I+ +++H + EN + T+++ VVG + + H+Y Sbjct: 841 MWKQISNELNHILLENDMKFTVVVGDVVGILAQGKKMIRPQPMEHKY 887
>POLG_DEN2N (P14340) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3391 Score = 29.6 bits (65), Expect = 5.9 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 168 LWKDITTKIHHKVSENWISATLLITPVVGTYQ 263 +WK IT +++H +SEN + T++ + G Q Sbjct: 842 MWKQITPELNHILSENEVKLTIMTGDIKGIMQ 873
>POLG_DEN2J (P07564) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3391 Score = 29.6 bits (65), Expect = 5.9 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 168 LWKDITTKIHHKVSENWISATLLITPVVGTYQ 263 +WK IT +++H +SEN + T++ + G Q Sbjct: 842 MWKQITPELNHILSENEVKLTIMTGDIKGIMQ 873
>POLG_DEN27 (P29991) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3391 Score = 29.6 bits (65), Expect = 5.9 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 168 LWKDITTKIHHKVSENWISATLLITPVVGTYQ 263 +WK IT +++H +SEN + T++ + G Q Sbjct: 842 MWKQITPELNHILSENEVKLTIMTGDIKGIMQ 873
>POLG_DEN26 (P29990) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3391 Score = 29.6 bits (65), Expect = 5.9 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 168 LWKDITTKIHHKVSENWISATLLITPVVGTYQ 263 +WK IT +++H +SEN + T++ + G Q Sbjct: 842 MWKQITPELNHILSENEVKLTIMTGDIKGIMQ 873
>DPOE_SCHPO (P87154) DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7)| (DNA polymerase II subunit A) Length = 2199 Score = 29.3 bits (64), Expect = 7.8 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 247 TGVMRSVAEIQFSETLWWILVVMSFHRPGITCCW 146 T V++S AE+ F E LW IL + PGI W Sbjct: 1282 TNVLQSSAEVMF-ENLWHILQIRETDVPGILHAW 1314
>ARRB_DROMI (P19108) Phosrestin-1 (Phosrestin I) (Arrestin B) (Arrestin-2) (49| kDa arrestin-like protein) Length = 401 Score = 29.3 bits (64), Expect = 7.8 Identities = 16/36 (44%), Positives = 26/36 (72%), Gaps = 3/36 (8%) Frame = -2 Query: 470 KVSLQVTLTASLHMHGKR--KRVQLGNDS-KNVKSL 372 K+SL+VTL ++ HG++ VQ+ N+S K+VKS+ Sbjct: 195 KISLEVTLDREIYYHGEKTAATVQVSNNSKKSVKSI 230
>ARRB_DROME (P19107) Phosrestin-1 (Phosrestin I) (Arrestin B) (Arrestin-2) (49| kDa arrestin-like protein) Length = 401 Score = 29.3 bits (64), Expect = 7.8 Identities = 16/36 (44%), Positives = 26/36 (72%), Gaps = 3/36 (8%) Frame = -2 Query: 470 KVSLQVTLTASLHMHGKR--KRVQLGNDS-KNVKSL 372 K+SL+VTL ++ HG++ VQ+ N+S K+VKS+ Sbjct: 195 KISLEVTLDREIYYHGEKTAATVQVSNNSKKSVKSI 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,010,322 Number of Sequences: 219361 Number of extensions: 1115353 Number of successful extensions: 3015 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3015 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)