Clone Name | baak4c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PCXB_ACIAD (P20372) Protocatechuate 3,4-dioxygenase beta chain (... | 29 | 3.8 | 2 | VEF_GVPU (P41723) Viral-enhancing factor (VEF) (Enhancin) (104 k... | 28 | 8.5 | 3 | YD183_YEAST (P48569) Hypothetical 37.0 kDa protein in RPL41A-INH... | 28 | 8.5 |
---|
>PCXB_ACIAD (P20372) Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)| (3,4-PCD) Length = 241 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 27 IHAMLVHIGWSAALLSQFYFSFQSYVNIRAYVFKHLPT*AEKDA 158 IH L+ GW+ L+SQFYF + ++ + K +P+ ++ A Sbjct: 162 IHFSLIADGWAQRLISQFYFEGDTLID-SCPILKTIPSEQQRRA 204
>VEF_GVPU (P41723) Viral-enhancing factor (VEF) (Enhancin) (104 kDa| glycoprotein) (Synergistic factor) Length = 901 Score = 27.7 bits (60), Expect = 8.5 Identities = 15/63 (23%), Positives = 27/63 (42%), Gaps = 4/63 (6%) Frame = +3 Query: 12 VEVTDIHAMLVHIGWSAA---LLSQFYFSFQS-YVNIRAYVFKHLPT*AEKDAYENHSTG 179 +EV H + + W ++++ YF ++ + YVF P K Y S+G Sbjct: 80 MEVEHAHESVPFVDWPVGERNIMAEVYFEIDGPHIPLPVYVFNTRPVEHFKSEYRQSSSG 139 Query: 180 YTY 188 Y + Sbjct: 140 YCF 142
>YD183_YEAST (P48569) Hypothetical 37.0 kDa protein in RPL41A-INH1 intergenic| region Length = 320 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 1/20 (5%) Frame = +3 Query: 78 FYFSFQSYVNIRAYV-FKHL 134 FY S+++YVNI+AY+ KHL Sbjct: 218 FYLSYRAYVNIKAYLGAKHL 237 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,098,379 Number of Sequences: 219361 Number of extensions: 493907 Number of successful extensions: 999 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 999 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)