Clone Name | baak4c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SLIT2_RAT (Q9WVC1) Slit homolog 2 protein precursor (Slit-2) (Fr... | 30 | 4.7 |
---|
>SLIT2_RAT (Q9WVC1) Slit homolog 2 protein precursor (Slit-2) (Fragment)| Length = 766 Score = 30.0 bits (66), Expect = 4.7 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -3 Query: 189 ISGLSWRXXXXXXXXTARVLNRVPPHV--AQSTCSG 88 +SG+ W+ +LN+V PH AQ +CSG Sbjct: 1 MSGIGWQTLSLSLALVLSILNKVAPHACPAQCSCSG 36 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,670,932 Number of Sequences: 219361 Number of extensions: 1348528 Number of successful extensions: 3157 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3069 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)