Clone Name | rbasdp19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AAPC_PENCL (Q40784) Putative apospory-associated protein C | 107 | 2e-23 | 2 | YMY9_YEAST (Q03161) Hypothetical UPF0010 protein YMR099c | 32 | 1.3 | 3 | CSTN1_HUMAN (O94985) Calsyntenin-1 precursor | 31 | 3.7 |
---|
>AAPC_PENCL (Q40784) Putative apospory-associated protein C| Length = 329 Score = 107 bits (268), Expect = 2e-23 Identities = 50/62 (80%), Positives = 56/62 (90%) Frame = -1 Query: 654 RSKTILDFGDEEYKHMLCVEPAAVEKPITLKPGEEWKGRLELSAVPSSYYSGQLDPDKVL 475 ++K + DFGD EYK+MLCVEPAAVEKPITLKPGEEW+GR+ LSAVPSSY SGQLDP KVL Sbjct: 268 KAKAMQDFGDAEYKNMLCVEPAAVEKPITLKPGEEWRGRIALSAVPSSYCSGQLDPLKVL 327 Query: 474 HG 469 HG Sbjct: 328 HG 329
>YMY9_YEAST (Q03161) Hypothetical UPF0010 protein YMR099c| Length = 297 Score = 32.3 bits (72), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -1 Query: 654 RSKTILDFGDEE-YKHMLCVEPAAVEKPITLKPGEEW 547 +S+ + DF + Y+ M+C+EP V I+L PG++W Sbjct: 244 KSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKW 280
>CSTN1_HUMAN (O94985) Calsyntenin-1 precursor| Length = 981 Score = 30.8 bits (68), Expect = 3.7 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 144 TSASEYQLLSDYCLYSSKICTYTILGTCWCE 52 TS + + DY L+ SKI T ++G CW E Sbjct: 477 TSHEPFSVTEDYPLHPSKIETQLVVGACWQE 507 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,183,416 Number of Sequences: 219361 Number of extensions: 2038607 Number of successful extensions: 5108 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4987 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5107 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)