Clone Name | rbasdp12 |
---|---|
Clone Library Name | barley_pub |
>SP63_STRPU (Q07929) 63 kDa sperm flagellar membrane protein precursor| Length = 470 Score = 31.2 bits (69), Expect = 3.3 Identities = 21/53 (39%), Positives = 26/53 (49%) Frame = +2 Query: 464 AACRVFSGVVADLLNRVYQAPEPDIVDPYLKEGEEQHGIMQWNLMEWVYRGRL 622 AA + V D L+ VYQA + D YL G W + EW+YRGRL Sbjct: 111 AAFASLAADVEDALDTVYQAST--MADIYL-------GSEVWGVPEWLYRGRL 154
>MTG8R_XENLA (Q9IAB2) Protein CBFA2T2 (MTG8-like protein) (MTG8-related protein| 1) Length = 586 Score = 30.4 bits (67), Expect = 5.7 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -2 Query: 163 EEDTAPSETHVNKLCIIIVAPRTQPVIPL 77 E +TAP+E V ++C I APR P + L Sbjct: 233 ERETAPAEPPVKRVCTISPAPRHSPALSL 261
>SREC2_MOUSE (P59222) Scavenger receptor class F member 2 precursor (Scavenger| receptor expressed by endothelial cells 2 protein) (SREC-II) Length = 833 Score = 30.4 bits (67), Expect = 5.7 Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -3 Query: 567 SSPSFRYGSTMSG-SGAWYTRLRRSATTPEKTLH-AAGPSLSPS 442 SS S R S++ G SGA Y R+ R P +T + A G SLSPS Sbjct: 597 SSDSERSASSVEGPSGALYARVARREARPARTRNEAGGLSLSPS 640
>PYRG_MYCPU (Q98PQ3) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 539 Score = 30.0 bits (66), Expect = 7.4 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = -2 Query: 640 PFYLGIQPSPVYPFHQVPLHNAMLFLSFLQVWVHN 536 PFYLG+Q P F PL LF SFL+V + N Sbjct: 506 PFYLGVQYHP--EFTSRPLKPNPLFTSFLRVLIKN 538
>DPO3A_UREPA (Q9PQ74) DNA polymerase III alpha subunit (EC 2.7.7.7)| Length = 969 Score = 30.0 bits (66), Expect = 7.4 Identities = 12/42 (28%), Positives = 26/42 (61%) Frame = -1 Query: 359 FAFSRSVSGNSIQDHITYLGVSMHAEAWSSCRIVMDYAELRY 234 +A SV+ + D I YLG+ +++ +++ + +DY +L+Y Sbjct: 841 YAKDMSVNDRYLDDEIQYLGIDLNSLNYANYKTEIDYNKLKY 882 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109,199,813 Number of Sequences: 219361 Number of extensions: 2385615 Number of successful extensions: 7094 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7077 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7309604013 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)