| Clone Name | rbasdo01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLPQ2_ARATH (Q9SZ11) Probable glycerophosphoryl diester phosphod... | 32 | 1.6 | 2 | GLPQ1_ARATH (Q9FJ62) Probable glycerophosphoryl diester phosphod... | 31 | 3.6 | 3 | ADEN_ADEB4 (O71150) Adenain (EC 3.4.22.39) (Endoprotease) (Late ... | 30 | 7.9 | 4 | ARLY_COREF (Q8FTM8) Argininosuccinate lyase (EC 4.3.2.1) (Argino... | 30 | 7.9 |
|---|
>GLPQ2_ARATH (Q9SZ11) Probable glycerophosphoryl diester phosphodiesterase 2| precursor (EC 3.1.4.46) Length = 759 Score = 32.3 bits (72), Expect = 1.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 382 PQAQPPTVSPMPGLNATEVQQPPFPPVASK 293 P A PP +P P +V +PP PPV +K Sbjct: 689 PTAFPPAEAPNPVFTDADVTEPPLPPVTAK 718
>GLPQ1_ARATH (Q9FJ62) Probable glycerophosphoryl diester phosphodiesterase 1| precursor (EC 3.1.4.46) Length = 766 Score = 31.2 bits (69), Expect = 3.6 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 382 PQAQPPTVSPMPGLNATEVQQPPFPPVASK 293 P + PP +P P +V +PP PPV+++ Sbjct: 696 PASLPPAEAPSPVFTDADVTEPPLPPVSAR 725
>ADEN_ADEB4 (O71150) Adenain (EC 3.4.22.39) (Endoprotease) (Late L3 23 kDa| protein) Length = 201 Score = 30.0 bits (66), Expect = 7.9 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 457 RNLNDASPAQRPCDPSSYHESSD 525 ++LN ASP+ P DPSS H++ D Sbjct: 147 QSLNGASPSLTPSDPSSLHKNQD 169
>ARLY_COREF (Q8FTM8) Argininosuccinate lyase (EC 4.3.2.1) (Arginosuccinase)| (ASAL) Length = 477 Score = 30.0 bits (66), Expect = 7.9 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 8/58 (13%) Frame = -1 Query: 398 ELGFDSSGSAANRVTDARIERNRGAAAAIPACRV--------QECTSWCRPTSGFIAV 249 ELGFDS AA+ DA R+ + AA ++ +E +WC P G+I + Sbjct: 223 ELGFDS---AADNSIDATSSRDFASEAAFVLAQIAVDMSRLAEEIIAWCTPEFGYIVL 277 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,335,547 Number of Sequences: 219361 Number of extensions: 1960151 Number of successful extensions: 5325 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5316 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7819576386 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)