ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasdn10 |
|---|---|
| Clone Library Name | barley_pub |
>RR16_WHEAT (Q95H63) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 69.7 bits (169), Expect = 5e-12 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDLRKVGFYDPIK +TCLNVP Sbjct: 15 AVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVP 51
>RR16_ORYSA (P12151) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 69.7 bits (169), Expect = 5e-12 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDLRKVGFYDPIK +TCLNVP Sbjct: 15 AVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVP 51
>RR16_ORYNI (Q6ENJ5) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 69.7 bits (169), Expect = 5e-12 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDLRKVGFYDPIK +TCLNVP Sbjct: 15 AVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVP 51
>RR16_HORVU (P25875) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 69.7 bits (169), Expect = 5e-12 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDLRKVGFYDPIK +TCLNVP Sbjct: 15 AVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVP 51
>RR16_SACOF (Q6ENY4) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 69.3 bits (168), Expect = 7e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 A+YRIVA DVRSRRE RDLRKVGFYDPIK +TCLNVP Sbjct: 15 AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVP 51
>RR16_SACHY (Q6L3B4) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 69.3 bits (168), Expect = 7e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 A+YRIVA DVRSRRE RDLRKVGFYDPIK +TCLNVP Sbjct: 15 AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVP 51
>RR16_MAIZE (P27723) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 69.3 bits (168), Expect = 7e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 A+YRIVA DVRSRRE RDLRKVGFYDPIK +TCLNVP Sbjct: 15 AIYRIVAIDVRSRREGRDLRKVGFYDPIKNQTCLNVP 51
>RR16_PANGI (Q68S24) Chloroplast 30S ribosomal protein S16| Length = 78 Score = 68.2 bits (165), Expect = 2e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDLRKVGFYDPIK ++CLNVP Sbjct: 15 AVYRIVAIDVRSRREGRDLRKVGFYDPIKNQSCLNVP 51
>RR16_LOTJA (P58125) Chloroplast 30S ribosomal protein S16| Length = 80 Score = 65.1 bits (157), Expect = 1e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDLRKVGFYDPIK +T LN+P Sbjct: 15 AVYRIVAIDVRSRREGRDLRKVGFYDPIKNQTYLNIP 51
>RR16_TOBAC (P06374) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 64.3 bits (155), Expect = 2e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE +DLRKVGFYDPIK +T LNVP Sbjct: 15 AVYRIVAIDVRSRREGKDLRKVGFYDPIKNQTYLNVP 51
>RR16_SPIOL (P28807) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 64.3 bits (155), Expect = 2e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDL+KVGFYDPIK +T LNVP Sbjct: 15 AVYRIVAIDVRSRREGRDLQKVGFYDPIKSQTYLNVP 51
>RR16_SILLA (Q589B0) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 63.9 bits (154), Expect = 3e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDL+KVGFYDPIK +T LNVP Sbjct: 15 AVYRIVAIDVRSRREGRDLQKVGFYDPIKNQTYLNVP 51
>RR16_NYMAL (Q6EW66) Chloroplast 30S ribosomal protein S16| Length = 86 Score = 63.5 bits (153), Expect = 4e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 A YRI+A DVRSRRE RDLRKVGFYDPIK +T LNVP Sbjct: 15 ATYRIIAIDVRSRREGRDLRKVGFYDPIKNQTYLNVP 51
>RR16_CALFE (Q7YJY6) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 63.2 bits (152), Expect = 5e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 A+YRIVA DVRSRRE RDLRKVGFYDPI +T LNVP Sbjct: 15 AIYRIVAIDVRSRREGRDLRKVGFYDPINNQTYLNVP 51
>RR16_SOLTU (P32087) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 62.8 bits (151), Expect = 6e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE +DL+KVGFYDPIK +T LNVP Sbjct: 15 AVYRIVAIDVRSRREGKDLQKVGFYDPIKNQTYLNVP 51
>RR16_SINAL (P10359) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 62.0 bits (149), Expect = 1e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDLRKVGFYDPI +T LN+P Sbjct: 15 AVYRIVAIDVRSRREGRDLRKVGFYDPITNQTYLNLP 51
>RR16_OENHO (Q9MTQ0) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 58.5 bits (140), Expect = 1e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 AVYRIVA DVRSRRE RDL KVGFYDPI +T L++P Sbjct: 15 AVYRIVAIDVRSRREGRDLWKVGFYDPINNKTYLDIP 51
>RR16_AMBTC (Q70Y15) Chloroplast 30S ribosomal protein S16| Length = 78 Score = 57.0 bits (136), Expect = 4e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 110 VYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 +YRIVA DVRSRR+ R LRKVGFYDPIK +T NVP Sbjct: 16 IYRIVAIDVRSRRDGRALRKVGFYDPIKNQTYSNVP 51
>RR16_ARATH (P56806) Chloroplast 30S ribosomal protein S16| Length = 79 Score = 53.5 bits (127), Expect = 4e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 AVYRI+A DVR RRE RDL KVGFYDPI +T LN+ Sbjct: 15 AVYRILAIDVRYRREGRDLSKVGFYDPITNQTFLNL 50
>RR16_MESVI (Q9MUR5) Chloroplast 30S ribosomal protein S16| Length = 84 Score = 43.9 bits (102), Expect = 3e-04 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 YR++A D R RR+ + L+++GFYDPI +T L+VP Sbjct: 17 YRVIAIDSRCRRDGKALKELGFYDPIAGKTQLDVP 51
>RR16_HUPLU (Q5SCW6) Chloroplast 30S ribosomal protein S16| Length = 84 Score = 43.9 bits (102), Expect = 3e-04 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 A YRIVA D RSR R +++VG YDPIK +T N+P Sbjct: 15 ATYRIVAIDARSRGXGRAIQEVGSYDPIKDQTQXNMP 51
>RR16_CHAGL (Q8MA02) Chloroplast 30S ribosomal protein S16| Length = 83 Score = 40.0 bits (92), Expect = 0.004 Identities = 17/34 (50%), Positives = 26/34 (76%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRI+A D ++RRE + L+++GFY+PIK L+V Sbjct: 17 YRIIAIDAKNRREGKALKELGFYNPIKNSIQLDV 50
>RR16_ANTFO (Q85CF2) Chloroplast 30S ribosomal protein S16| Length = 84 Score = 38.9 bits (89), Expect = 0.010 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRIVA D +SRRE R L +VGFY+ K +T L++ Sbjct: 17 YRIVAIDAQSRREGRALEEVGFYNLRKDQTQLDI 50
>RR16_PORPU (P51352) Chloroplast 30S ribosomal protein S16| Length = 82 Score = 37.4 bits (85), Expect = 0.029 Identities = 15/34 (44%), Positives = 25/34 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRIVA D RS+R+ + + ++GFY+PI T +++ Sbjct: 17 YRIVAMDSRSKRDGKAIEELGFYNPITNETRIDI 50
>RS16_GLOVI (Q7NH99) 30S ribosomal protein S16| Length = 89 Score = 36.2 bits (82), Expect = 0.064 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -3 Query: 110 VYRIVAXDVRSRREXRDLRKVGFYDP 33 VYRIV D RSRR+ + ++GFYDP Sbjct: 11 VYRIVVTDSRSRRDGAVIEEIGFYDP 36
>RS16_SYNY3 (P74410) 30S ribosomal protein S16| Length = 82 Score = 35.8 bits (81), Expect = 0.084 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 YRIVA +RR+ R L ++GFY+P T L+VP Sbjct: 17 YRIVAMHSTTRRDGRPLEELGFYNPRTDETRLDVP 51
>RS16_SYNEL (Q8DMS1) 30S ribosomal protein S16| Length = 83 Score = 35.4 bits (80), Expect = 0.11 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPI 30 A YRIVA + RR+ R L ++GFYDPI Sbjct: 15 ATYRIVAMNNTDRRDGRALEELGFYDPI 42
>RS16_THEAQ (O07348) 30S ribosomal protein S16| Length = 88 Score = 35.0 bits (79), Expect = 0.14 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIK 27 YRIV DVR +R+ + K+G+YDP K Sbjct: 17 YRIVVTDVRRKRDGAYIEKIGYYDPRK 43
>RS16_THETH (P80379) 30S ribosomal protein S16| Length = 91 Score = 34.7 bits (78), Expect = 0.19 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIK 27 YRIV D R +R+ + + K+G+YDP K Sbjct: 20 YRIVVTDARRKRDGKYIEKIGYYDPRK 46
>RS16_THET8 (Q5SJH3) 30S ribosomal protein S16| Length = 88 Score = 34.7 bits (78), Expect = 0.19 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIK 27 YRIV D R +R+ + + K+G+YDP K Sbjct: 17 YRIVVTDARRKRDGKYIEKIGYYDPRK 43
>RS16_THET2 (P62238) 30S ribosomal protein S16| Length = 88 Score = 34.7 bits (78), Expect = 0.19 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIK 27 YRIV D R +R+ + + K+G+YDP K Sbjct: 17 YRIVVTDARRKRDGKYIEKIGYYDPRK 43
>RS16_ANASP (Q8YVM2) 30S ribosomal protein S16| Length = 86 Score = 34.7 bits (78), Expect = 0.19 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 A YRIVA + SRR+ R L ++G+Y+P L+VP Sbjct: 15 ASYRIVAMNNLSRRDGRPLEELGYYNPRTDEVRLDVP 51
>RS16_THIFE (Q9L9C8) 30S ribosomal protein S16| Length = 86 Score = 34.3 bits (77), Expect = 0.24 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y IV D RSRR+ R + ++GFY+PI Sbjct: 17 YHIVVADSRSRRDGRFIERLGFYNPI 42
>RS16_NEIMB (P66438) 30S ribosomal protein S16| Length = 81 Score = 34.3 bits (77), Expect = 0.24 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y ++ D RSRR+ R + +VGFY+P+ Sbjct: 17 YNVIVTDSRSRRDGRFIERVGFYNPV 42
>RS16_NEIMA (P66437) 30S ribosomal protein S16| Length = 81 Score = 34.3 bits (77), Expect = 0.24 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y ++ D RSRR+ R + +VGFY+P+ Sbjct: 17 YNVIVTDSRSRRDGRFIERVGFYNPV 42
>RS16_GEOSL (P62230) 30S ribosomal protein S16| Length = 95 Score = 34.3 bits (77), Expect = 0.24 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 Y+I+ DVRSRR+ R + VG YDP Sbjct: 25 YQIIVADVRSRRDGRFIENVGTYDP 49
>RS16_BORPE (Q7VXD8) 30S ribosomal protein S16| Length = 86 Score = 34.3 bits (77), Expect = 0.24 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y +VA D R+RR+ R + +VGFY+P+ Sbjct: 17 YNLVATDSRNRRDGRFVERVGFYNPV 42
>RS16_BORPA (Q7W6N6) 30S ribosomal protein S16| Length = 86 Score = 34.3 bits (77), Expect = 0.24 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y +VA D R+RR+ R + +VGFY+P+ Sbjct: 17 YNLVATDSRNRRDGRFVERVGFYNPV 42
>RS16_BORBR (Q7WHL9) 30S ribosomal protein S16| Length = 86 Score = 34.3 bits (77), Expect = 0.24 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y +VA D R+RR+ R + +VGFY+P+ Sbjct: 17 YNLVATDSRNRRDGRFVERVGFYNPV 42
>RR16_GRATL (Q6B914) Chloroplast 30S ribosomal protein S16| Length = 78 Score = 34.3 bits (77), Expect = 0.24 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRI+ D R R+ R + ++GFY P+ ++ +N+ Sbjct: 17 YRIIVIDSRKPRDGRPIEEIGFYSPLNNKSKINL 50
>RS16_XANCP (Q8PBC3) 30S ribosomal protein S16| Length = 86 Score = 33.9 bits (76), Expect = 0.32 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y I+ DVRS R+ R++ ++G+Y+P+ Sbjct: 17 YHIIVTDVRSARDGRNIERLGYYNPV 42
>RS16_XANAC (Q8PMY3) 30S ribosomal protein S16| Length = 85 Score = 33.9 bits (76), Expect = 0.32 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y I+ DVRS R+ R++ ++G+Y+P+ Sbjct: 17 YHIIVTDVRSARDGRNIERLGYYNPV 42
>RS16_CHRVO (Q7NRV5) 30S ribosomal protein S16| Length = 83 Score = 33.9 bits (76), Expect = 0.32 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y IV D R+RR+ R + +VGFY+P+ Sbjct: 17 YNIVVTDSRNRRDGRFIERVGFYNPV 42
>RS16_RALSO (Q8Y0W0) 30S ribosomal protein S16| Length = 84 Score = 33.5 bits (75), Expect = 0.42 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 + IVA D R+RR+ R + +VGFY+P+ Sbjct: 17 FNIVATDSRNRRDGRFIERVGFYNPL 42
>RS16_STRAW (Q82JW0) 30S ribosomal protein S16| Length = 142 Score = 33.1 bits (74), Expect = 0.54 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRIV D R+RR+ R + ++G Y P++ + + V Sbjct: 18 YRIVVADSRTRRDGRAIEEIGLYHPVQNPSRMEV 51
>RS16_DESVH (P62229) 30S ribosomal protein S16| Length = 79 Score = 33.1 bits (74), Expect = 0.54 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPI 30 A YRIVA + +RR+ R L +GFY+P+ Sbjct: 16 AFYRIVAVNSETRRDGRPLEYIGFYNPM 43
>RS16_PROMP (Q7TU65) 30S ribosomal protein S16| Length = 114 Score = 32.7 bits (73), Expect = 0.71 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLN 9 A +RIVA + SRR+ R L+++GFY+P T L+ Sbjct: 15 ASFRIVACNSTSRRDGRPLQELGFYNPRTKETRLD 49
>RR16_CYAPA (P48139) Cyanelle 30S ribosomal protein S16| Length = 77 Score = 32.7 bits (73), Expect = 0.71 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRIVA + SRR+ + + ++GFY+P + LN+ Sbjct: 17 YRIVAMNNLSRRDGKAIEELGFYNPRTNESSLNI 50
>RR16_ADICA (Q85FN9) Chloroplast 30S ribosomal protein S16| Length = 78 Score = 32.7 bits (73), Expect = 0.71 Identities = 14/34 (41%), Positives = 25/34 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRIVA + +SR+E + +++V FY+P + T L++ Sbjct: 16 YRIVAIESQSRQEGKVIKEVEFYNPRREETQLDI 49
>RS16_CLOPE (Q8XJP4) 30S ribosomal protein S16| Length = 81 Score = 32.3 bits (72), Expect = 0.93 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YR+V D RS R+ R + ++G+Y+PI Sbjct: 18 YRVVVADSRSPRDGRFIEEIGYYNPI 43
>RR16_GUITH (O78423) Chloroplast 30S ribosomal protein S16| Length = 76 Score = 32.3 bits (72), Expect = 0.93 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 A YR+V S+R+ R + ++GFY+P T +NV Sbjct: 15 ASYRLVVMPSTSKRDGRAIEELGFYNPCTNETHINV 50
>RS16_PROMA (Q7VAU5) 30S ribosomal protein S16| Length = 131 Score = 32.0 bits (71), Expect = 1.2 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLN 9 A +R+VA + SRR+ R L+++GFY+P T L+ Sbjct: 15 ASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLD 49
>RS16_PROMM (Q7TV43) 30S ribosomal protein S16| Length = 122 Score = 32.0 bits (71), Expect = 1.2 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLN 9 A +R+VA + SRR+ R L+++GFY+P T L+ Sbjct: 15 ASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLD 49
>RS16_SYNPX (Q7TTU5) 30S ribosomal protein S16| Length = 140 Score = 32.0 bits (71), Expect = 1.2 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLN 9 A +R+VA + SRR+ R L+++GFY+P T L+ Sbjct: 15 ASFRLVACNSTSRRDGRPLQELGFYNPRTKETRLD 49
>RS16_XYLFT (Q87F56) 30S ribosomal protein S16| Length = 86 Score = 32.0 bits (71), Expect = 1.2 Identities = 13/38 (34%), Positives = 25/38 (65%), Gaps = 4/38 (10%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI----KXRTCLNV 6 Y+I+ D R++R+ R++ +VG Y+P+ + R LN+ Sbjct: 17 YQIIVTDSRNKRDGRNIERVGHYNPVAQGAESRVVLNM 54
>RS16_XYLFA (Q9PH39) 30S ribosomal protein S16| Length = 86 Score = 32.0 bits (71), Expect = 1.2 Identities = 13/38 (34%), Positives = 25/38 (65%), Gaps = 4/38 (10%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI----KXRTCLNV 6 Y+I+ D R++R+ R++ +VG Y+P+ + R LN+ Sbjct: 17 YQIIVTDSRNKRDGRNIERVGHYNPVAQGAESRVVLNM 54
>RS16_THETN (Q8R9X1) 30S ribosomal protein S16| Length = 82 Score = 32.0 bits (71), Expect = 1.2 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YRIV D RS R+ R + ++G+Y+PI Sbjct: 18 YRIVVADSRSPRDGRFIDEIGYYNPI 43
>RS16_STAS1 (Q49X24) 30S ribosomal protein S16| Length = 88 Score = 32.0 bits (71), Expect = 1.2 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YRIVA D R+ R+ R++ ++G Y+P Sbjct: 18 YRIVAADARAPRDGRNIEQIGTYNP 42
>RS16_HAEIN (P44382) 30S ribosomal protein S16| Length = 82 Score = 32.0 bits (71), Expect = 1.2 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 161 LHVSRGGVVYLHLSX*AVYRIVAXDVRSRREXRDLRKVGFYDPI 30 + +SRGG Y+IV D RS R+ R + +VGF++PI Sbjct: 4 IRLSRGGA-----KKRPFYQIVVADSRSPRDGRFIERVGFFNPI 42
>RS16_WOLPM (P62240) 30S ribosomal protein S16| Length = 106 Score = 31.6 bits (70), Expect = 1.6 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YRIV D R+ R+ R + K+G YDP+ Sbjct: 18 YRIVVADSRAPRDGRFIEKIGQYDPM 43
>RS16_OCEIH (Q8ER01) 30S ribosomal protein S16| Length = 90 Score = 31.6 bits (70), Expect = 1.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YRIV D RS R+ R + ++G Y+P+ Sbjct: 18 YRIVVADSRSPRDGRSIEQIGTYNPV 43
>RS16_ENTFA (Q834F9) 30S ribosomal protein S16| Length = 91 Score = 31.6 bits (70), Expect = 1.6 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIK 27 YRIV D RS R+ R + VG Y+P+K Sbjct: 18 YRIVVADSRSPRDGRFIETVGTYNPLK 44
>RS16_THEMA (Q9X1Q2) 30S ribosomal protein S16| Length = 95 Score = 31.2 bits (69), Expect = 2.1 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIK 27 YRIV D R RR+ + +G+Y+P+K Sbjct: 17 YRIVVVDSRKRRDGAYIESLGYYNPLK 43
>RS16_PHOLL (Q7N7A0) 30S ribosomal protein S16| Length = 82 Score = 31.2 bits (69), Expect = 2.1 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y++V D RS R+ R + +VGF++PI Sbjct: 17 YQVVVTDSRSPRDGRFIERVGFFNPI 42
>RS16_PASMU (P58123) 30S ribosomal protein S16| Length = 82 Score = 31.2 bits (69), Expect = 2.1 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -3 Query: 161 LHVSRGGVVYLHLSX*AVYRIVAXDVRSRREXRDLRKVGFYDPI 30 + +SRGG Y+IV D RS R+ R + +VGF++P+ Sbjct: 4 IRLSRGGA-----KKRPFYQIVVADSRSPRDGRFIERVGFFNPL 42
>RS16_SPIKU (P62237) 30S ribosomal protein S16| Length = 119 Score = 31.2 bits (69), Expect = 2.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 113 AVYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLN 9 A YRIVA D R +R+ + +G Y+PI +N Sbjct: 15 AFYRIVATDARVKRDGEYIELIGTYNPINGYVKIN 49
>RS16_CHLCV (Q822M5) 30S ribosomal protein S16| Length = 119 Score = 31.2 bits (69), Expect = 2.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 110 VYRIVAXDVRSRREXRDLRKVGFYDP 33 VYR+V DV S R+ R + +G+YDP Sbjct: 17 VYRLVLADVESPRDGRYIELLGWYDP 42
>RS16_CORDI (P62228) 30S ribosomal protein S16| Length = 157 Score = 30.8 bits (68), Expect = 2.7 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YR+V D R+RR+ + + +G Y+P Sbjct: 18 YRVVVADARTRRDGKVIENIGIYEP 42
>RS16_AQUAE (O66523) 30S ribosomal protein S16| Length = 112 Score = 30.4 bits (67), Expect = 3.5 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 110 VYRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 +YRIV D +S RE + + +G YDP K + +NV Sbjct: 17 IYRIVVMDAKSPREGKYIDILGTYDP-KRKVLINV 50
>RS16_YERPE (Q8ZBU7) 30S ribosomal protein S16| Length = 82 Score = 30.4 bits (67), Expect = 3.5 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y++V D R+ R+ R + +VGF++PI Sbjct: 17 YQVVVTDSRNARDGRFIERVGFFNPI 42
>RS16_STAAW (P66441) 30S ribosomal protein S16| Length = 91 Score = 30.4 bits (67), Expect = 3.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 YRIV D RS R+ R + ++G Y+P T N P Sbjct: 18 YRIVVADARSPRDGRIIEQIGTYNP----TSANAP 48
>RS16_STAAS (Q6G9X5) 30S ribosomal protein S16| Length = 91 Score = 30.4 bits (67), Expect = 3.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 YRIV D RS R+ R + ++G Y+P T N P Sbjct: 18 YRIVVADARSPRDGRIIEQIGTYNP----TSANAP 48
>RS16_STAAR (Q6GHJ7) 30S ribosomal protein S16| Length = 91 Score = 30.4 bits (67), Expect = 3.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 YRIV D RS R+ R + ++G Y+P T N P Sbjct: 18 YRIVVADARSPRDGRIIEQIGTYNP----TSANAP 48
>RS16_STAAN (P66440) 30S ribosomal protein S16| Length = 91 Score = 30.4 bits (67), Expect = 3.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 YRIV D RS R+ R + ++G Y+P T N P Sbjct: 18 YRIVVADARSPRDGRIIEQIGTYNP----TSANAP 48
>RS16_STAAM (P66439) 30S ribosomal protein S16| Length = 91 Score = 30.4 bits (67), Expect = 3.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 YRIV D RS R+ R + ++G Y+P T N P Sbjct: 18 YRIVVADARSPRDGRIIEQIGTYNP----TSANAP 48
>RS16_STAAC (Q5HGJ4) 30S ribosomal protein S16| Length = 91 Score = 30.4 bits (67), Expect = 3.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNVP 3 YRIV D RS R+ R + ++G Y+P T N P Sbjct: 18 YRIVVADARSPRDGRIIEQIGTYNP----TSANAP 48
>RS16_LACJO (P62231) 30S ribosomal protein S16| Length = 90 Score = 30.4 bits (67), Expect = 3.5 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YRIV D R R+ R + +VG+Y+P+ Sbjct: 18 YRIVVADSRMPRDGRFIEEVGYYNPL 43
>RS16_HAEDU (Q7VKG0) 30S ribosomal protein S16| Length = 82 Score = 30.4 bits (67), Expect = 3.5 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y+IV D RS R+ R + ++GF++P+ Sbjct: 17 YQIVVADSRSPRDGRFIERIGFFNPL 42
>RS16_CHLTR (O84029) 30S ribosomal protein S16| Length = 116 Score = 30.0 bits (66), Expect = 4.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 110 VYRIVAXDVRSRREXRDLRKVGFYDP 33 VYR+V DV S R+ + + +G+YDP Sbjct: 17 VYRLVLADVESPRDGKYIELLGWYDP 42
>RS16_CHLMU (Q9PL13) 30S ribosomal protein S16| Length = 116 Score = 30.0 bits (66), Expect = 4.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 110 VYRIVAXDVRSRREXRDLRKVGFYDP 33 VYR+V DV S R+ + + +G+YDP Sbjct: 17 VYRLVLADVESPRDGKYIELLGWYDP 42
>RS16_STRLI (O86868) 30S ribosomal protein S16| Length = 139 Score = 30.0 bits (66), Expect = 4.6 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YRIV D R+RR+ R + ++G Y P Sbjct: 18 YRIVVADSRTRRDGRAIEEIGKYHP 42
>RS16_STRCO (O69879) 30S ribosomal protein S16| Length = 139 Score = 30.0 bits (66), Expect = 4.6 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YRIV D R+RR+ R + ++G Y P Sbjct: 18 YRIVVADSRTRRDGRAIEEIGKYHP 42
>RS16_MYCLE (O33014) 30S ribosomal protein S16| Length = 160 Score = 30.0 bits (66), Expect = 4.6 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YR++ D R+RR+ R + +G Y P + + +++ Sbjct: 18 YRVIVADARTRRDGRSIEVIGRYHPKEEPSLIDI 51
>RS16_LEIXX (Q6AE98) 30S ribosomal protein S16| Length = 153 Score = 30.0 bits (66), Expect = 4.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRIV D R++R+ R + ++G Y P + + + V Sbjct: 18 YRIVVADSRTKRDGRVIEEIGLYHPTEEPSRIEV 51
>RS16_WIGBR (Q8D2V3) 30S ribosomal protein S16| Length = 80 Score = 30.0 bits (66), Expect = 4.6 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y+IVA D R R+ + + K+GF++PI Sbjct: 17 YQIVASDNRKPRDGKFIEKLGFFNPI 42
>RS16_TREDE (P62239) 30S ribosomal protein S16| Length = 81 Score = 30.0 bits (66), Expect = 4.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIK 27 YRIV DVR R + + +VG Y PI+ Sbjct: 17 YRIVVQDVREPRNGKTIDEVGIYHPIE 43
>RS16_STAHJ (Q4L5U0) 30S ribosomal protein S16| Length = 91 Score = 30.0 bits (66), Expect = 4.6 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YRIV D RS R+ R + ++G Y+P Sbjct: 18 YRIVVADARSPRDGRIIEQIGTYNP 42
>RS16_NITEU (Q82U38) 30S ribosomal protein S16| Length = 89 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 Y +V D R+RR+ + + +VGFY+P Sbjct: 17 YSMVVADSRNRRDGKFIERVGFYNP 41
>RS16_LACPL (Q88WJ5) 30S ribosomal protein S16| Length = 90 Score = 30.0 bits (66), Expect = 4.6 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YRIV D RS R+ R + +VG Y+P+ Sbjct: 18 YRIVVADSRSPRDGRFIAQVGTYNPL 43
>RS16_BACSU (P21474) 30S ribosomal protein S16 (BS17)| Length = 89 Score = 30.0 bits (66), Expect = 4.6 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YRIV D RS R+ R + VG Y+P+ Sbjct: 17 YRIVVADSRSPRDGRFIETVGTYNPV 42
>RS16_BACCR (Q819W3) 30S ribosomal protein S16| Length = 90 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YR+V D RS R+ R + ++G Y+P+ Sbjct: 18 YRVVVADSRSPRDGRFIEEIGTYNPV 43
>RS16_BACC1 (P62226) 30S ribosomal protein S16| Length = 90 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YR+V D RS R+ R + ++G Y+P+ Sbjct: 18 YRVVVADSRSPRDGRFIEEIGTYNPV 43
>RS16_BACAN (Q81WJ3) 30S ribosomal protein S16| Length = 90 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YR+V D RS R+ R + ++G Y+P+ Sbjct: 18 YRVVVADSRSPRDGRFIEEIGTYNPV 43
>RR16_CYAME (Q85G24) Chloroplast 30S ribosomal protein S16| Length = 75 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLN 9 YR+V ++RR+ + + +GFY+PI + +N Sbjct: 17 YRVVVMRSQTRRDGKAIEDLGFYNPISKQCVIN 49
>RS16_CHLPN (Q9Z965) 30S ribosomal protein S16| Length = 119 Score = 30.0 bits (66), Expect = 4.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 110 VYRIVAXDVRSRREXRDLRKVGFYDP 33 VYR+V DV S R+ + + +G+YDP Sbjct: 17 VYRLVLADVESPRDGKYIELLGWYDP 42
>RS16_TREPA (O83875) 30S ribosomal protein S16| Length = 123 Score = 29.6 bits (65), Expect = 6.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YRIV D R R+ R + ++G Y PI Sbjct: 18 YRIVVQDAREPRDGRAIEELGIYQPI 43
>RS16_COREF (Q8FP30) 30S ribosomal protein S16| Length = 168 Score = 29.6 bits (65), Expect = 6.0 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YR+V D R++R+ + + +G Y+P Sbjct: 18 YRVVVADARTKRDGKVIENIGIYEP 42
>RS16_TROWT (Q83G64) 30S ribosomal protein S16| Length = 148 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRIV D R++R+ + + +VG Y P++ + + + Sbjct: 18 YRIVVADSRTKRDGKVIEQVGKYHPVQNPSFIEI 51
>RS16_TROW8 (Q83I06) 30S ribosomal protein S16| Length = 148 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLNV 6 YRIV D R++R+ + + +VG Y P++ + + + Sbjct: 18 YRIVVADSRTKRDGKVIEQVGKYHPVQNPSFIEI 51
>RS16_AGRT5 (Q8UBZ9) 30S ribosomal protein S16| Length = 126 Score = 29.6 bits (65), Expect = 6.0 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y+IV D RS R+ R L KVG ++P+ Sbjct: 18 YQIVVADARSPRDGRFLEKVGSWNPM 43
>RS16_SHIFL (P0A7T6) 30S ribosomal protein S16| Length = 82 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y++V D R+ R R + +VGF++PI Sbjct: 17 YQVVVADSRNARNGRFIERVGFFNPI 42
>RS16_SALTY (P0A2A9) 30S ribosomal protein S16| Length = 82 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y++V D R+ R R + +VGF++PI Sbjct: 17 YQVVVTDSRNARNGRFIERVGFFNPI 42
>RS16_SALTI (P0A2B0) 30S ribosomal protein S16| Length = 82 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y++V D R+ R R + +VGF++PI Sbjct: 17 YQVVVTDSRNARNGRFIERVGFFNPI 42
>RS16_MYCPE (Q8EWV0) 30S ribosomal protein S16| Length = 132 Score = 29.6 bits (65), Expect = 6.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPIKXRTCLN 9 +RIV D R+RR+ + KVG Y+P + +N Sbjct: 17 FRIVVIDSRARRDGAYIEKVGTYEPFEGVVNIN 49
>RS16_ECOLI (P0A7T3) 30S ribosomal protein S16| Length = 82 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y++V D R+ R R + +VGF++PI Sbjct: 17 YQVVVADSRNARNGRFIERVGFFNPI 42
>RS16_ECOL6 (P0A7T4) 30S ribosomal protein S16| Length = 82 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y++V D R+ R R + +VGF++PI Sbjct: 17 YQVVVADSRNARNGRFIERVGFFNPI 42
>RS16_ECO57 (P0A7T5) 30S ribosomal protein S16| Length = 82 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 Y++V D R+ R R + +VGF++PI Sbjct: 17 YQVVVADSRNARNGRFIERVGFFNPI 42
>RS16_BACST (P81290) 30S ribosomal protein S16 (BS15)| Length = 88 Score = 29.6 bits (65), Expect = 6.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YRIV D RS R+ R + +G Y+P+ Sbjct: 17 YRIVVADSRSPRDGRFIETIGTYNPV 42
>RS16_BACHD (Q9KA11) 30S ribosomal protein S16| Length = 90 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YR+V D RS R+ R + ++G Y+P+ Sbjct: 18 YRVVVADSRSPRDGRFIEEIGTYNPL 43
>RS16_CORGL (Q8NNX3) 30S ribosomal protein S16| Length = 165 Score = 29.3 bits (64), Expect = 7.9 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YR+V D R++R+ + + +G Y+P Sbjct: 18 YRVVIADARTKRDGKVIENIGIYEP 42
>T23O_HUMAN (P48775) Tryptophan 2,3-dioxygenase (EC 1.13.11.11) (Tryptophan| pyrrolase) (Tryptophanase) (Tryptophan oxygenase) (Tryptamin 2,3-dioxygenase) (TRPO) Length = 406 Score = 29.3 bits (64), Expect = 7.9 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -1 Query: 226 LISXXIDRNSNHFLEPYEEKTSYTFLGGALFIYIY 122 L+S ++ H L E + SY L GAL IY Y Sbjct: 264 LLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFY 298
>RS16_STAES (Q8CSV0) 30S ribosomal protein S16| Length = 91 Score = 29.3 bits (64), Expect = 7.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YRIV D RS R+ R + ++G Y+P Sbjct: 18 YRIVVADARSPRDGRIIEQLGTYNP 42
>RS16_STAEQ (Q5HPV3) 30S ribosomal protein S16| Length = 91 Score = 29.3 bits (64), Expect = 7.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YRIV D RS R+ R + ++G Y+P Sbjct: 18 YRIVVADARSPRDGRIIEQLGTYNP 42
>RS16_LEPIN (Q8F3L1) 30S ribosomal protein S16| Length = 88 Score = 29.3 bits (64), Expect = 7.9 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP--IKXRTCLN 9 YRIVA D RS R+ + + VG Y P IK +T N Sbjct: 17 YRIVAADSRSPRDGKFVDIVGHYHPAQIKEQTTFN 51
>RS16_LEPIC (P62232) 30S ribosomal protein S16| Length = 88 Score = 29.3 bits (64), Expect = 7.9 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP--IKXRTCLN 9 YRIVA D RS R+ + + VG Y P IK +T N Sbjct: 17 YRIVAADSRSPRDGKFVDIVGHYHPAQIKEQTTFN 51
>RS16_HELPY (P56023) 30S ribosomal protein S16| Length = 76 Score = 29.3 bits (64), Expect = 7.9 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YR+V D R RR+ + +G+Y+P+ Sbjct: 17 YRVVVTDSRKRRDGGWIESIGYYNPL 42
>RS16_HELPJ (Q9ZK63) 30S ribosomal protein S16| Length = 76 Score = 29.3 bits (64), Expect = 7.9 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YR+V D R RR+ + +G+Y+P+ Sbjct: 17 YRVVVTDSRKRRDGGWIESIGYYNPL 42
>RS16_CLOAB (Q97I97) 30S ribosomal protein S16| Length = 81 Score = 29.3 bits (64), Expect = 7.9 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDP 33 YRIV D RS R+ + + ++G+Y+P Sbjct: 17 YRIVVADSRSPRDGKFIEELGYYNP 41
>RS16_CAMJE (Q9PPJ7) 30S ribosomal protein S16| Length = 75 Score = 29.3 bits (64), Expect = 7.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 107 YRIVAXDVRSRREXRDLRKVGFYDPI 30 YRIV D R RR+ + +G+Y+P+ Sbjct: 17 YRIVVTDSRKRRDGGWIESIGYYNPM 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,695,027 Number of Sequences: 219361 Number of extensions: 784963 Number of successful extensions: 1605 Number of sequences better than 10.0: 119 Number of HSP's better than 10.0 without gapping: 1598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1605 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
