Clone Name | rbasdm10 |
---|---|
Clone Library Name | barley_pub |
>KRA94_HUMAN (Q9BYQ2) Keratin-associated protein 9-4 (Keratin-associated protein| 9.4) (Ultrahigh sulfur keratin-associated protein 9.4) Length = 154 Score = 33.5 bits (75), Expect = 0.30 Identities = 20/63 (31%), Positives = 25/63 (39%) Frame = -1 Query: 194 TTVLQLASYTCVHVMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPX 15 TTV +S C C P CC+ S + C C + CC PTC P Sbjct: 27 TTVTTCSSTPC------CQPS--CCVSSCCQP----CCRPTCCQNTCCQPTCVTSCCQPS 74 Query: 14 CCN 6 CC+ Sbjct: 75 CCS 77
>KRB2A_SHEEP (P02438) Keratin, high-sulfur matrix protein, B2A| Length = 171 Score = 32.3 bits (72), Expect = 0.66 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCC-----ALSVCLSH*CCTPTCRRLGIDPXCC 9 C+P CC L +A SCC S C CC PTC +P CC Sbjct: 121 CTPPS-CCQLYYAQA--SCCRPSYCGQSCCRPACCCQPTCIEPICEPSCC 167
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 32.3 bits (72), Expect = 0.66 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 C P CC+ S CC C S CC PTC R P CC Sbjct: 24 CRPS--CCVSS-------CCRPQCCQSV-CCQPTCCRPSCCPSCC 58 Score = 31.6 bits (70), Expect = 1.1 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 C P CC S + SCC S C+S C + C+ + P CC Sbjct: 88 CQPT--CCRPSCSIS--SCCRPSCCVSRCCRSQCCQSVCCQPTCC 128
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 32.3 bits (72), Expect = 0.66 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -1 Query: 164 CVHVMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 CV V C P CCL + + SCC S C C + +C++ P CC Sbjct: 89 CVPVC--CKP--VCCLPTCSKDSSSCCQQSSCQPTCCASSSCQQSCCVPVCC 136 Score = 31.2 bits (69), Expect = 1.5 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = -1 Query: 164 CVHVMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 CV V C P CC+ + E SCC S C C + C++ P CC Sbjct: 131 CVPVC--CKP--VCCVPTCSEDSSSCCQHSSCQPTCCTSSPCQQSCYVPVCC 178 Score = 30.8 bits (68), Expect = 1.9 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = -1 Query: 176 ASYTCVHVMGPCSPDLYCCLLSV--EEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCCNK 3 +S C H C P CC S + Y C VC CC P C G CC + Sbjct: 149 SSSCCQH--SSCQPT--CCTSSPCQQSCYVPVCCKPVCFKPICCVPVCS--GASTSCCQQ 202 Score = 28.5 bits (62), Expect = 9.6 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPT--------CRRLGIDPXCC 9 C P CC S + SCC + VC CC PT C+ P CC Sbjct: 116 CQPT--CCASSSCQQ--SCC-VPVCCKPVCCVPTCSEDSSSCCQHSSCQPTCC 163
>KRB2D_SHEEP (P08131) Keratin, high-sulfur matrix protein, B2D| Length = 181 Score = 32.0 bits (71), Expect = 0.87 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Frame = -1 Query: 125 CCLLSVEEAY*SCC-----ALSVCLSH*CCTPTCRRLGIDPXCC 9 CC L +A SCC S C CC PTC +P CC Sbjct: 136 CCQLYYAQA--SCCRPSYCGQSCCRPACCCQPTCIEPVCEPTCC 177
>KRA13_HUMAN (Q8IUG1) Keratin-associated protein 1-3 (Keratin-associated protein| 1.8) (Keratin-associated protein 1.9) Length = 177 Score = 32.0 bits (71), Expect = 0.87 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXC 12 C+P CC L EA SCC S C CC P C +P C Sbjct: 138 CTPPT-CCQLHHAEA--SCCRPSYC-GQSCCRPVCCCYSCEPTC 177
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 31.6 bits (70), Expect = 1.1 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 9/63 (14%) Frame = -1 Query: 164 CVHVMGPCSPDLYCCLLSVEEAY*SCCALSVC---------LSH*CCTPTCRRLGIDPXC 12 CV V C P CC+ + E SCC S C H CC P C G C Sbjct: 229 CVPVC--CVP--VCCVPTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCS--GASTSC 282 Query: 11 CNK 3 C + Sbjct: 283 CQQ 285 Score = 28.9 bits (63), Expect = 7.3 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 C P C +SV SCC S C S C + C++ P CC Sbjct: 120 CKP---VCCVSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCC 161 Score = 28.9 bits (63), Expect = 7.3 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTC-RRLGIDPXCC 9 C+P CC S + +CCA S C CC P C + + P CC Sbjct: 85 CTPS--CCQQSSCQL--ACCASSPCQQA-CCVPVCCKTVCCKPVCC 125
>KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-associated protein| 4.5) (Ultrahigh sulfur keratin-associated protein 4.5) Length = 186 Score = 31.2 bits (69), Expect = 1.5 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = -1 Query: 167 TCVH----VMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 TC H + C P YCC S CC S C + C T CR P CC Sbjct: 54 TCCHPSCCISSCCRP--YCCESSCCRP--CCCRPSCCQTTCCRTTCCRTTCCCPSCC 106 Score = 28.5 bits (62), Expect = 9.6 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 +CC S C+S C C+ + P CC Sbjct: 99 TCCCPSCCVSSCCRPQCCQSVCCQPTCC 126
>KRA98_HUMAN (Q9BYQ0) Keratin-associated protein 9-8 (Keratin-associated protein| 9.8) (Ultrahigh sulfur keratin-associated protein 9.8) Length = 159 Score = 31.2 bits (69), Expect = 1.5 Identities = 19/63 (30%), Positives = 24/63 (38%) Frame = -1 Query: 194 TTVLQLASYTCVHVMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPX 15 TTV +S C C P CC+ S + C C + CC P C P Sbjct: 22 TTVTTCSSTPC------CQPS--CCVSSCCQP----CCRPTCCQNTCCQPICVTSCCQPS 69 Query: 14 CCN 6 CC+ Sbjct: 70 CCS 72
>GIDB_RHOPA (Q6ND16) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 223 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = +1 Query: 229 WRARVRMVKAAKKRMVWTKM---ALPLVWRPPKSTRWCDPGISNSSPGV 366 W+A+ +V + +WT+ +L LV P + RW D G PGV Sbjct: 45 WQAKTNLVAPSTLPQLWTRHVADSLQLVSLMPHARRWLDFGSGGGFPGV 93
>KRA92_HUMAN (Q9BYQ4) Keratin-associated protein 9-2 (Keratin-associated protein| 9.2) (Ultrahigh sulfur keratin-associated protein 9.2) Length = 174 Score = 30.8 bits (68), Expect = 1.9 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 4/67 (5%) Frame = -1 Query: 194 TTVLQLASYTCVHVMGPCSPDLYCCLLSVEEAY*SCC----ALSVCLSH*CCTPTCRRLG 27 TTV +S +C C P CC+ S + CC + C CC PTC Sbjct: 27 TTVTTCSSTSC------CQPA--CCVSSCCQP---CCRPTSCQNTCCRTTCCQPTCVTSC 75 Query: 26 IDPXCCN 6 P CC+ Sbjct: 76 CQPSCCS 82
>GIDB_BRAJA (Q89WP6) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 260 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = +1 Query: 229 WRARVRMVKAAKKRMVWTKM---ALPLVWRPPKSTRWCDPGISNSSPGV 366 W+A+ +V + +WT+ +L LV P + RW D G PGV Sbjct: 83 WQAKTNLVAPSTLPHLWTRHIADSLQLVDLAPTARRWADLGSGGGFPGV 131
>KR109_HUMAN (P60411) Keratin-associated protein 10-9 (Keratin-associated| protein 10.9) (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9) Length = 292 Score = 30.8 bits (68), Expect = 1.9 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = -1 Query: 164 CVHVMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 CV V C P CC + E SCC S C C + C++ P CC Sbjct: 141 CVPVC--CKP--VCCAPTCSEDSYSCCQQSSCQPACCTSSPCQQSCCVPVCC 188 Score = 30.0 bits (66), Expect = 3.3 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTC-RRLGIDPXCC 9 CS D Y C +CC S C CC P C + + P CC Sbjct: 155 CSEDSYSCCQQ-SSCQPACCTSSPCQQS-CCVPVCCKPVCCKPICC 198 Score = 29.3 bits (64), Expect = 5.6 Identities = 21/67 (31%), Positives = 25/67 (37%), Gaps = 12/67 (17%) Frame = -1 Query: 173 SYTCVHVMGPCSPDLYCCLLSVEEAY*SCCA----LSVCLSH*CCTPT--------CRRL 30 SY+C C P CC S + SCC VC CC P C++ Sbjct: 159 SYSCCQ-QSSCQPA--CCTSSPCQQ--SCCVPVCCKPVCCKPICCVPVCSGASSLCCQQS 213 Query: 29 GIDPXCC 9 G P CC Sbjct: 214 GCQPACC 220
>KRA93_HUMAN (Q9BYQ3) Keratin-associated protein 9-3 (Keratin-associated protein| 9.3) (Ultrahigh sulfur keratin-associated protein 9.3) Length = 159 Score = 30.8 bits (68), Expect = 1.9 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = -1 Query: 194 TTVLQLASYTCVHVMGPCSPDLYCCLLSVEE--AY*SCCALSVCLSH*CCTPTCRRLGID 21 TTV +S C C P CC+ S + + +CC + C + CC P C Sbjct: 22 TTVTTCSSTPC------CQPS--CCVSSCCQPCCHPTCCQNTCCRTT-CCQPICVTSCCQ 72 Query: 20 PXCCN 6 P CC+ Sbjct: 73 PSCCS 77 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/50 (24%), Positives = 18/50 (36%) Frame = -1 Query: 158 HVMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 H PC C + + C+ + C CC +C + P CC Sbjct: 3 HCCSPCCQPTCCRTTCWQPTTVTTCSSTPCCQPSCCVSSCCQPCCHPTCC 52
>KRA48_HUMAN (Q9BYQ9) Keratin-associated protein 4-8 (Keratin-associated protein| 4.8) (Ultrahigh sulfur keratin-associated protein 4.8) (Fragment) Length = 114 Score = 30.4 bits (67), Expect = 2.5 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCCN 6 C P CC+ S CC S C+S C C+ + P CC+ Sbjct: 19 CHPS--CCISS-------CCRPSCCVSSCCKPQCCQSVCCQPTCCH 55 Score = 28.5 bits (62), Expect = 9.6 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 5/58 (8%) Frame = -1 Query: 167 TCVH----VMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLG-IDPXCC 9 TC H + C P CC+ S + C SVC CC P+C P CC Sbjct: 17 TCCHPSCCISSCCRPS--CCVSSCCKPQ---CCQSVCCQPTCCHPSCSISSCCRPSCC 69
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 30.4 bits (67), Expect = 2.5 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 C P CC+ S CC S C+S C C+ + P CC Sbjct: 110 CHPS--CCISS-------CCRPSCCVSRCCRPQCCQSVCCQPTCC 145 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCCN 6 SCC S C+S C C+ + P CC+ Sbjct: 83 SCCRPSCCMSSCCKPQCCQSVCCQPTCCH 111 Score = 28.9 bits (63), Expect = 7.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 SCC C S CC PTC R P CC Sbjct: 48 SCCRPQCCQSV-CCQPTCCR----PSCC 70
>KRA44_HUMAN (Q9BYR3) Keratin-associated protein 4-4 (Keratin-associated protein| 4.4) (Ultrahigh sulfur keratin-associated protein 4.4) Length = 166 Score = 30.0 bits (66), Expect = 3.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 SCC S C C T CR P CC Sbjct: 39 SCCVSSCCRPQCCQTTCCRTTCCHPSCC 66
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 30.0 bits (66), Expect = 3.3 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = -1 Query: 164 CVHVMGPCSPDLYCCLLSVEEAY*SCCALSVCLS----H*CCTPTCRRLGIDPXCC 9 CV V C P CC+ + + SCC + C S CC P C + P CC Sbjct: 229 CVPVC--CKP--VCCVPTCSDDSGSCCQPACCTSSQSQQGCCVPVCCK----PVCC 276 Score = 29.6 bits (65), Expect = 4.3 Identities = 18/55 (32%), Positives = 21/55 (38%) Frame = -1 Query: 167 TCVHVMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCCNK 3 TC G C CC S + CC + VC CC P C G CC + Sbjct: 242 TCSDDSGSCCQPA-CCTSSQSQQ--GCC-VPVCCKPVCCVPVCS--GASTSCCQQ 290 Score = 29.6 bits (65), Expect = 4.3 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 C +YC + ++ SCC S C S C + C++ P CC Sbjct: 119 CCKPVYCVPVCSGDS--SCCQQSSCQSACCTSSPCQQACCVPICC 161
>KR412_HUMAN (Q9BQ66) Keratin-associated protein 4-12 (Keratin-associated| protein 4.12) (Ultrahigh sulfur keratin-associated protein 4.12) Length = 201 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 +CC S C+S CC C P CC Sbjct: 139 TCCRPSCCISSSCCPSCCESSCCRPCCC 166
>PPIB_TREPA (O66105) Probable peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 215 Score = 29.6 bits (65), Expect = 4.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 331 CDPGISNSSPGVSRMKSTTPTTTGPQ 408 CDP + + SPGV M + P T G Q Sbjct: 119 CDPALRHDSPGVLSMANAGPGTNGSQ 144
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 29.6 bits (65), Expect = 4.3 Identities = 17/58 (29%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = -1 Query: 164 CVHVMGPC----SPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCCNK 3 C PC S CC S + C + +C CC P C G CC K Sbjct: 138 CSGASSPCCQQSSCQSACCTFSPCQ---QACCVPICCKPICCVPVCS--GASSLCCQK 190 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 C P CC+ A CC S C S C C++ P CC Sbjct: 129 CKP--VCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICC 171
>KRA43_HUMAN (Q9BYR4) Keratin-associated protein 4-3 (Keratin-associated protein| 4.3) (Ultrahigh sulfur keratin-associated protein 4.3) (Fragment) Length = 98 Score = 29.6 bits (65), Expect = 4.3 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPT-CRRLGIDPXCC 9 C P CC+ S CC S C+S CC P+ C+ P CC Sbjct: 3 CRPS--CCISS-------CCRPSCCISS-CCKPSCCQTTCCRPSCC 38
>KR414_HUMAN (Q9BYQ6) Keratin-associated protein 4-14 (Keratin-associated| protein 4.14) (Ultrahigh sulfur keratin-associated protein 4.14) Length = 195 Score = 29.6 bits (65), Expect = 4.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCCN 6 SCC S C+S C C+ + P CC+ Sbjct: 108 SCCRPSCCVSSCCRPQCCQSVCCQPTCCH 136 Score = 29.6 bits (65), Expect = 4.3 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 SCC S C+S C C+ + P CC Sbjct: 73 SCCRPSCCVSSCCKPQCCQSMCCQPTCC 100 Score = 29.3 bits (64), Expect = 5.6 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 C P CC+ S CC C S CC PTC R P CC Sbjct: 75 CRPS--CCVSS-------CCKPQCCQSM-CCQPTCCR----PRCC 105 Score = 29.3 bits (64), Expect = 5.6 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 143 CSPDLYC---CLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 C YC C +S SCC C S CC PTC R P CC Sbjct: 34 CCRTTYCRPSCCVS------SCCRPQCCQSV-CCQPTCCR----PRCC 70
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 29.6 bits (65), Expect = 4.3 Identities = 20/62 (32%), Positives = 24/62 (38%), Gaps = 10/62 (16%) Frame = -1 Query: 164 CVHVMGPCSPDLYCCLLSVEEAY*SCCALSVC---------LSH*CCTPT-CRRLGIDPX 15 CV V C P CC+ + E SCC S C CC P C+ + P Sbjct: 147 CVPVC--CKP--VCCVSTCSEDSSSCCQQSSCQPACCTSSSYQQACCVPVCCKTVYCKPI 202 Query: 14 CC 9 CC Sbjct: 203 CC 204 Score = 28.5 bits (62), Expect = 9.6 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 C P CC+ A SCC S C C + +C+ P CC Sbjct: 110 CKP--VCCVPVCCGAASSCCRQSSCQPACCASSSCQPACCVPVCC 152
>KR10C_HUMAN (P60413) Keratin-associated protein 10-12 (Keratin-associated| protein 10.12) (High sulfur keratin-associated protein 10.12) (Keratin-associated protein 18-12) (Keratin-associated protein 18.12) Length = 245 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/54 (27%), Positives = 18/54 (33%), Gaps = 7/54 (12%) Frame = -1 Query: 143 CSPDLYCCLLS-------VEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCCNK 3 C P CC S + C + VC CC P C G CC + Sbjct: 125 CGPSSSCCQQSSCQPACCISSPCQQSCCVPVCCKPICCVPVCS--GASSLCCQQ 176
>KRB2C_SHEEP (P02440) Keratin, high-sulfur matrix protein, B2C| Length = 151 Score = 29.3 bits (64), Expect = 5.6 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = -1 Query: 125 CCLLSVEEAY*SCC-----ALSVCLSH*CCTPTCRRLGIDPXC 12 CC L +A SCC S C CC PTC +P C Sbjct: 106 CCQLYYAQA--SCCRPSYCGQSCCRPACCCQPTCTEPVCEPTC 146
>KRA99_HUMAN (Q9BYP9) Keratin-associated protein 9-9 (Keratin-associated| protein 9.9) (Ultrahigh sulfur keratin-associated protein 9.9) Length = 154 Score = 29.3 bits (64), Expect = 5.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 89 CCALSVCLSH*CCTPTCRRLGIDPXCC 9 CC S C+S CC P CR P CC Sbjct: 37 CCQPSCCVSS-CCQPCCR-----PACC 57
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 28.9 bits (63), Expect = 7.3 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -1 Query: 143 CSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTC-RRLGIDPXCC 9 C+P CC S + +CCA S C CC P C + + P CC Sbjct: 85 CTPS--CCQQSSCQL--ACCASSPCQQA-CCVPVCCKTVCCKPVCC 125 Score = 28.5 bits (62), Expect = 9.6 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = -1 Query: 125 CCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 CC E SCC S C C + C++ P CC Sbjct: 238 CCKPVCSEDSSSCCQQSSCQPACCTSSPCQQACCVPVCC 276
>KRA49_HUMAN (Q9BYQ8) Keratin-associated protein 4-9 (Keratin-associated protein| 4.9) (Ultrahigh sulfur keratin-associated protein 4.9) (Fragment) Length = 191 Score = 28.9 bits (63), Expect = 7.3 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 SCC S C+S C C+ + P CC Sbjct: 104 SCCRPSCCVSSCCKPQCCQSVCCQPNCC 131 Score = 28.9 bits (63), Expect = 7.3 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 5/58 (8%) Frame = -1 Query: 167 TCVH----VMGPCSPDLYCCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLG-IDPXCC 9 TC H + C P CC+ S + C SVC CC P+C P CC Sbjct: 94 TCCHPRCCISSCCRPS--CCVSSCCKPQ---CCQSVCCQPNCCRPSCSISSCCRPSCC 146 Score = 28.9 bits (63), Expect = 7.3 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = -1 Query: 92 SCCALSV----CLSH*CCTPTCRRLGIDPXCC 9 SCC S C CC PTC R P CC Sbjct: 24 SCCVSSCCRPQCCQSVCCQPTCSR----PSCC 51
>KRA54_HUMAN (Q6L8H1) Keratin-associated protein 5-4 (Keratin-associated protein| 5.4) (Ultrahigh sulfur keratin-associated protein 5.4) Length = 288 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 SCC C S CC P C G CC Sbjct: 238 SCCKPYCCQSS-CCKPCCSSSGCGSSCC 264
>KRB2B_SHEEP (P02439) Keratin, high-sulfur matrix protein, B2B| Length = 156 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = -1 Query: 125 CCLLSVEEAY*SCC-----ALSVCLSH*CCTPTCRRLGIDPXC 12 CC L +A SCC S C CC PTC +P C Sbjct: 116 CCQLYYAQA--SCCRPSYCGQSCCRPACCCQPTCIEPVCEPTC 156
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 28.5 bits (62), Expect = 9.6 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -1 Query: 125 CCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 CC S ++ SCC C CC P C G CC Sbjct: 150 CCKPSCSQS--SCCK-PCCSQSSCCKPCCCSSGCGSSCC 185
>VID21_NEUCR (Q7SBU6) Chromatin modification-related protein vid-21| Length = 2189 Score = 28.5 bits (62), Expect = 9.6 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 10 QQXGSIPSRRQVGVQHQ*DKQTDRAQQLQYASSTDSKQQYRSGEHG 147 Q+ + ++QV HQ ++ ++QQ Q A +QQ + +HG Sbjct: 1751 QKTPQMQPQQQVQTPHQQAQKAQQSQQAQLAQQQQHQQQQQQQQHG 1796
>KRA42_HUMAN (Q9BYR5) Keratin-associated protein 4-2 (Keratin-associated protein| 4.2) (Ultrahigh sulfur keratin-associated protein 4.2) Length = 136 Score = 28.5 bits (62), Expect = 9.6 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 92 SCCALSVCLSH*CCTPTCRRLGIDPXCCN 6 +CC S C+S C C+ + P CC+ Sbjct: 34 TCCRPSCCVSSCCRPQCCQSVCCQPTCCS 62
>K0406_HUMAN (O43156) Protein KIAA0406| Length = 1089 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -3 Query: 165 LCACNGSVLARSVLLLAIS*RSVLKLLRSVCLFISLMLYSYLSSAGDRSXLLQQV 1 +C+ N ++ + L I + L + CL + LY L AGD++ L+ QV Sbjct: 617 ICSMNSNIWQICIQLEGIG-QFAYALGKDFCLLLMSALYPVLEKAGDQTLLISQV 670
>KR102_HUMAN (P60368) Keratin-associated protein 10-2 (Keratin-associated| protein 10.2) (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2) Length = 255 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -1 Query: 125 CCLLSVEEAY*SCCALSVCLSH*CCTPTCRRLGIDPXCC 9 CC+ + E+ SCC S C C + C++ CC Sbjct: 150 CCVPTCSESSSSCCQQSSCQPACCTSSPCQQSCCVSVCC 188 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,612,264 Number of Sequences: 219361 Number of extensions: 671866 Number of successful extensions: 2635 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 1973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2408 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)