Clone Name | rbasdm05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TF2L1_MOUSE (Q3UNW5) Transcription factor CP2-like protein 1 (CP... | 28 | 7.3 | 2 | CEP35_HUMAN (Q5VT06) Centrosome-associated protein 350 (Centroso... | 28 | 7.3 |
---|
>TF2L1_MOUSE (Q3UNW5) Transcription factor CP2-like protein 1 (CP2-related| transcriptional repressor-1) (CRTR-1) Length = 478 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 92 RLPQPQRQNTSGITSLCHHPSVF 160 +LP PQ+Q+ SG SLC + ++F Sbjct: 383 QLPLPQKQDDSGDNSLCVYHAIF 405
>CEP35_HUMAN (Q5VT06) Centrosome-associated protein 350 (Centrosome-associated| protein of 350 kDa) Length = 3117 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 74 DKTKVKRLPQPQRQNTSGITSLCHHPSVFRCL 169 D + PQP R +TSG TS + + CL Sbjct: 2408 DSQSCRDKPQPMRSSTSGATSFGSNEEISECL 2439 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,897,982 Number of Sequences: 219361 Number of extensions: 577101 Number of successful extensions: 1294 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1294 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)