Clone Name | rbasdk20 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LMO6_HUMAN (O43900) LIM domain only protein 6 (Triple LIM domain... | 32 | 1.6 | 2 | CCNT_DROME (O96433) Cyclin-T | 32 | 1.6 |
---|
>LMO6_HUMAN (O43900) LIM domain only protein 6 (Triple LIM domain protein 6)| Length = 615 Score = 32.3 bits (72), Expect = 1.6 Identities = 26/70 (37%), Positives = 32/70 (45%) Frame = -1 Query: 762 SARGPSIHPRRASSSGETSAPLAASTRSRQQWRGIASMPXXXXXSA*WQPPLSTNRPPLA 583 +A GPS RR+ S+G +APLAAST S +G + ST P Sbjct: 373 TAPGPS---RRSWSAGPVTAPLAASTASFSAVKGASETTTKGT---------STELAPAT 420 Query: 582 GA*PPSRSLR 553 G PSR LR Sbjct: 421 GPEEPSRFLR 430
>CCNT_DROME (O96433) Cyclin-T| Length = 1097 Score = 32.3 bits (72), Expect = 1.6 Identities = 31/119 (26%), Positives = 47/119 (39%), Gaps = 10/119 (8%) Frame = -1 Query: 756 RGPSIHPRRASS----SGETSAPLAASTRSRQQWRGIASMPXXXXXSA*WQPPLSTNRPP 589 R PS H R +SS SG S ++S+ S Q G SMP S+ PP+ PP Sbjct: 418 RMPSSHQRSSSSGLGSSGSGSQRSSSSSSSSSQQPGRPSMPVDYHKSSRGMPPVGVGMPP 477 Query: 588 ------LAGA*PPSRSLRTWSRNPNQSKCPNLCRNQNLSRTQNWIPNLCPNQCRSRSQN 430 +G+ P + + + +++ S++ PN P S QN Sbjct: 478 HGSHKMTSGSKPQQPQQQPVPHPSASNSSASGMSSKDKSQSNKMYPNAPPPYSNSAPQN 536 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,837,290 Number of Sequences: 219361 Number of extensions: 1288648 Number of successful extensions: 3238 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3225 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 8071525748 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)