Clone Name | rbasdj10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CD59_RAT (P27274) CD59 glycoprotein precursor (Membrane attack c... | 29 | 2.9 | 2 | DPOG1_MOUSE (P54099) DNA polymerase gamma subunit 1 (EC 2.7.7.7)... | 28 | 6.6 |
---|
>CD59_RAT (P27274) CD59 glycoprotein precursor (Membrane attack complex| inhibition factor) (MACIF) (MAC-inhibitory protein) (MAC-IP) (Protectin) Length = 126 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 Query: 97 DACWVVPRKNNLISAGWNGSDCKAKVILSQL 5 DAC V + W SDC AK ILS+L Sbjct: 46 DACLVAVSGKQVYQQCWRFSDCNAKFILSRL 76
>DPOG1_MOUSE (P54099) DNA polymerase gamma subunit 1 (EC 2.7.7.7) (Mitochondrial| DNA polymerase catalytic subunit) (PolG-alpha) Length = 1239 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 33 QSDPFQPAEMRLFFRGTTQHASVSKIQTPPTKRPPHSQHLP 155 Q DP P+E R T H + ++++ P QHLP Sbjct: 509 QEDPGPPSEEEELQRSVTAHNRLQQLRSTTDLLPKRPQHLP 549 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,936,388 Number of Sequences: 219361 Number of extensions: 410357 Number of successful extensions: 1410 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1399 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)