Clone Name | rbasdh10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CHD4_HUMAN (Q14839) Chromodomain helicase-DNA-binding protein 4 ... | 28 | 4.7 | 2 | MEU31_SCHPO (Q9Y826) Meiotic expression up-regulated protein 31 | 28 | 7.9 |
---|
>CHD4_HUMAN (Q14839) Chromodomain helicase-DNA-binding protein 4 (EC 3.6.1.-)| (ATP-dependent helicase CHD4) (CHD-4) (Mi-2 autoantigen 218 kDa protein) (Mi2-beta) Length = 1912 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +1 Query: 31 NMISESDRATNRANCTSLSSFRDTKRKRENISNDTPVRKLSTDHQ 165 N S SD +T+R++ S R TK+K++ T V TDHQ Sbjct: 327 NSYSVSDGSTSRSS-RSRKKLRTTKKKKKGEEEVTAVDGYETDHQ 370
>MEU31_SCHPO (Q9Y826) Meiotic expression up-regulated protein 31| Length = 185 Score = 27.7 bits (60), Expect = 7.9 Identities = 30/90 (33%), Positives = 35/90 (38%), Gaps = 13/90 (14%) Frame = -2 Query: 249 FGKAGFFCSWKSKNSIXHRXDVLHWSCRLVISAKFSYW---CII*Y--IFPFSFCVSETA 85 FG G F +WK K S H VL WS I A FS C I Y + P+ C A Sbjct: 56 FGAIGIFFAWKKKLSWEHL--VLLWS---TIDAFFSMCLRSCTIIYFSMNPYMLCEILNA 110 Query: 84 E*CAVCSVSRSVTF--------AYHIXLLC 19 CS++ F Y I LC Sbjct: 111 RNVISCSLNTQKFFFIIVAASNVYSIFQLC 140 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,095,478 Number of Sequences: 219361 Number of extensions: 435799 Number of successful extensions: 1043 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)