Clone Name | rbasdf11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC ... | 32 | 1.9 | 2 | R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [... | 30 | 9.2 | 3 | UVRC_VIBF1 (Q5E4C5) UvrABC system protein C (Protein uvrC) (Exci... | 30 | 9.2 | 4 | R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [... | 30 | 9.2 |
---|
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 32.0 bits (71), Expect = 1.9 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = -2 Query: 694 EEFAKWKAAFISMNRPEYLQDIDAVSARFQRRDVYGAWEQ---YLGLEHTDTTPKRSYTA 524 +EF K+K A + R +Y+ + + G +LGL+H + PKRS Sbjct: 1033 KEFEKFKFAIVMTGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRS--- 1089 Query: 523 NQNRHTY-EKPVKIYN 479 R+TY EK +KI+N Sbjct: 1090 ---RYTYLEKAIKIHN 1102
>R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7071 Score = 29.6 bits (65), Expect = 9.2 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 192 FVCVEQSWYIRKIFW*GHVYMVIAETDCFI--CCSCYWGI 79 FVCVE Y +F G+ I CF+ CC CY+G+ Sbjct: 3735 FVCVE---YYPLLFITGNTLQCIMLVYCFLGYCCCCYFGL 3771
>UVRC_VIBF1 (Q5E4C5) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 608 Score = 29.6 bits (65), Expect = 9.2 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 46 TKALYSLSHCSNAPITGAANKAISLSYNHVYMPLPKY 156 TKAL S H + +T + +A+ L +N++ LPKY Sbjct: 55 TKALVSHIHQVDVTVTHSETEALILEHNYIKQYLPKY 91
>R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7073 Score = 29.6 bits (65), Expect = 9.2 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 192 FVCVEQSWYIRKIFW*GHVYMVIAETDCFI--CCSCYWGI 79 FVCVE Y +F G+ I CF+ CC CY+G+ Sbjct: 3737 FVCVE---YYPLLFITGNTLQCIMLVYCFLGYCCCCYFGL 3773 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,851,349 Number of Sequences: 219361 Number of extensions: 2374710 Number of successful extensions: 5355 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5355 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6969622431 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)