Clone Name | rbasdf02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATBF1_MOUSE (Q61329) Alpha-fetoprotein enhancer-binding protein ... | 33 | 0.96 | 2 | PYRB_PYRAB (P77918) Aspartate carbamoyltransferase (EC 2.1.3.2) ... | 30 | 6.2 | 3 | BMP4_CHICK (Q90752) Bone morphogenetic protein 4 precursor (BMP-4) | 30 | 8.1 |
---|
>ATBF1_MOUSE (Q61329) Alpha-fetoprotein enhancer-binding protein (AT| motif-binding factor) (AT-binding transcription factor 1) Length = 3726 Score = 33.1 bits (74), Expect = 0.96 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = -3 Query: 320 RETITPVRRTRHFDLESIPGPQDPEKFSFWLVNLINLRPSDKLD 189 ++ +T ++ RH L S+P P + E + ++L +NL P+ K+D Sbjct: 837 QQNMTQIQHNRHLGLGSLPSPAEAELYQYYLAQNMNL-PNLKMD 879
>PYRB_PYRAB (P77918) Aspartate carbamoyltransferase (EC 2.1.3.2) (Aspartate| transcarbamylase) (ATCase) Length = 308 Score = 30.4 bits (67), Expect = 6.2 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 5/70 (7%) Frame = -2 Query: 669 LNIFEPRYRLMVRRIMEGNRRMGMVAIDSATGTVADCGCEVEIL-----ECEPLPDGRFY 505 L + P M R I+E R GM ++ T T+ D ++++L + E PD + Y Sbjct: 184 LYLISPELLRMPRHIVEELREKGMKVVE--TTTLEDVIGKLDVLYVTRIQKERFPDEQEY 241 Query: 504 LEVEGSRRVS 475 L+V+GS +V+ Sbjct: 242 LKVKGSYQVN 251
>BMP4_CHICK (Q90752) Bone morphogenetic protein 4 precursor (BMP-4)| Length = 405 Score = 30.0 bits (66), Expect = 8.1 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 1/87 (1%) Frame = -3 Query: 413 FSLPEGSQERRDLIERANEASELARTYIRRARETITPVRRTRHFD-LESIPGPQDPEKFS 237 + L G +E R L E++ Y R+ VR H + LES+PGP + + Sbjct: 88 YRLQSGEEEERSL-------QEISLQYPERSASRANTVRSFHHEEHLESVPGPSEAPRIR 140 Query: 236 FWLVNLINLRPSDKLDLLRLCDTRERI 156 F + NL ++ ++ + L RE++ Sbjct: 141 F-VFNLSSVPDNEVISSEELRLYREQV 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109,804,839 Number of Sequences: 219361 Number of extensions: 2258191 Number of successful extensions: 5524 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5524 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 8015081512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)