ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasde01 |
|---|---|
| Clone Library Name | barley_pub |
>OST2_RAT (Q80W66) Heparan sulfate glucosamine 3-O-sulfotransferase 2 (EC| 2.8.2.29) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2) (Heparan sulfate 3-O-sulfotransferase 2) Length = 367 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +3 Query: 252 RPQSCPAPWPTRPSS----RAGRPAPG*KPESHGGDPSPWSR 365 RP P P P+ PS+ A PAP +H G P P ++ Sbjct: 71 RPCDPPGPTPSEPSAPSAPAAAAPAPRLSGSNHSGSPKPGTK 112
>OST2_MOUSE (Q673U1) Heparan sulfate glucosamine 3-O-sulfotransferase 2 (EC| 2.8.2.29) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2) (Heparan sulfate 3-O-sulfotransferase 2) Length = 367 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +3 Query: 252 RPQSCPAPWPTRPSS----RAGRPAPG*KPESHGGDPSPWSR 365 RP P P P+ PS+ A PAP +H G P P ++ Sbjct: 71 RPCDPPGPTPSEPSAPSAPAAAAPAPRLSGSNHSGSPKPGTK 112
>WASL_RAT (O08816) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 501 Score = 29.3 bits (64), Expect = 4.5 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 246 ELRPQSCPAPWPTRPSSRAGRPAPG*KPESHGGDPSP 356 ELR Q+ P P P SR G P P P S G P P Sbjct: 268 ELRRQAPPPP----PPSRGGPPPPPPPPHSSGPPPPP 300
>WASL_MOUSE (Q91YD9) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 501 Score = 29.3 bits (64), Expect = 4.5 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 246 ELRPQSCPAPWPTRPSSRAGRPAPG*KPESHGGDPSP 356 ELR Q+ P P P SR G P P P S G P P Sbjct: 268 ELRRQAPPPP----PPSRGGPPPPPPPPHSSGPPPPP 300
>ZDHC4_RAT (Q5FVR1) Probable palmitoyltransferase ZDHHC4 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 4) (DHHC-4) Length = 343 Score = 29.3 bits (64), Expect = 4.5 Identities = 10/42 (23%), Positives = 22/42 (52%) Frame = -1 Query: 333 FLVFILVQVCLLLMMAASAKVQGRTVAGVPACCSYRPECCER 208 +L F+L+ V ++ + S +++ + G C P+C +R Sbjct: 10 YLAFLLICVIMICIFTKSQRLKAVVLGGAQVCARVTPQCFQR 51
>ZDHC4_MOUSE (Q9D6H5) Probable palmitoyltransferase ZDHHC4 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 4) (DHHC-4) Length = 343 Score = 29.3 bits (64), Expect = 4.5 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = -1 Query: 333 FLVFILVQVCLLLMMAASAKVQGRTVAGVPACCSYRPECCER 208 +L F+L+ V L+ + S +++ + G C P+C +R Sbjct: 10 YLAFLLICVVLICIFTKSQRLKAVVLGGAQVCSRVIPQCLQR 51
>WASL_BOVIN (Q95107) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 29.3 bits (64), Expect = 4.5 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 246 ELRPQSCPAPWPTRPSSRAGRPAPG*KPESHGGDPSP 356 ELR Q+ P P P SR G P P P S G P P Sbjct: 271 ELRRQAPPPP----PPSRGGPPPPPPPPHSSGPPPPP 303
>RIC8_CAEBR (Q61A92) Synembryn (Resistance to inhibitors of cholinesterase| protein 8) Length = 567 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = -1 Query: 438 LSRSRKELSSVFGTDLCSLAKQEPIETMAMGHLRGFLVFILVQVCLLLMMAASAKVQGR 262 +SR R+ L S+ +LC + T +G+ R + Q CL+ M SAK++ R Sbjct: 74 ISRERQGLESLLNENLCDTILKLAGITPVVGYPRSVHALMEAQKCLVNTMFHSAKMRER 132
>R4RL2_RAT (Q80WD1) Reticulon-4 receptor-like 2 precursor (Nogo-66 receptor| homolog 1) (Nogo-66 receptor-related protein 2) (NgR2) (Nogo receptor-like 3) Length = 420 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 258 QSCPAPWPTRPSSRA 302 Q+CP P PTRP SRA Sbjct: 308 QACPPPTPTRPGSRA 322
>R4RL2_MOUSE (Q7M6Z0) Reticulon-4 receptor-like 2 precursor (Nogo-66 receptor| homolog 1) (Nogo-66 receptor-related protein 2) (NgR2) (Nogo receptor-like 3) Length = 420 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 258 QSCPAPWPTRPSSRA 302 Q+CP P PTRP SRA Sbjct: 308 QACPPPTPTRPGSRA 322
>INVO_RAT (P48998) Involucrin| Length = 568 Score = 28.9 bits (63), Expect = 5.9 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 256 HSPALHLGRRGHHQE-QADLHQDENQKATEVTHRHGLD 366 H P LHLG++ H + + +LH E Q + H+ + Sbjct: 283 HEPELHLGKQQHQESCEPELHLGEQQHQEQQQHQESCE 320
>CVP3_PIMHY (Q8T0W3) Cysteine-rich venom protein 3 precursor| Length = 63 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -1 Query: 327 VFILVQVCLLLMMAASAKVQGRTVAGVPAC-CSYRPECCERLTAE 196 + +++ V L L++ A+++V G P CS ECCE L + Sbjct: 5 ITLILVVALALVLLATSEVSAYRACGFPGRRCSPTEECCEGLVCQ 49
>KCNN1_MOUSE (Q9EQR3) Small conductance calcium-activated potassium channel| protein 1 (SK1) Length = 580 Score = 28.5 bits (62), Expect = 7.7 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 7/48 (14%) Frame = +1 Query: 277 GRRGHHQEQADLHQDENQ-------KATEVTHRHGLDRFLFC*RAQIS 399 G RGH QEQ + ++E + K V+HR G R LF R ++S Sbjct: 100 GSRGHPQEQEEEEEEEEEEDKTGSGKPPTVSHRLGHRRALFEKRKRLS 147
>HXD11_MOUSE (P23813) Homeobox protein Hox-D11 (Hox-4.6) (Hox-5.5)| Length = 323 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 255 PQSCPAPWPTRPSSRAGRPAPG*KPESHGGDPSPWSRS 368 PQ PAP P +P A + P KP + GG SP +++ Sbjct: 178 PQPQPAPAPPQPEGAADKGDP--KPGAGGGGGSPCAKA 213
>SCND2_HUMAN (Q9GZW5) SCAN domain-containing protein 2| Length = 306 Score = 28.5 bits (62), Expect = 7.7 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = +3 Query: 177 RRRRAGLPPXXXXXXXXXXXXXXELRPQSCPAPWPT--RPSSRAGRPAPG*KP 329 +RRR G P +P+ P+P PT RP R RP G KP Sbjct: 229 QRRRPGTGPWRPGRQRGAGTAPPGTQPRQRPSPRPTPRRPRPRLARPRAGQKP 281 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,322,775 Number of Sequences: 219361 Number of extensions: 1270237 Number of successful extensions: 4061 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4040 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
