| Clone Name | rbasdd01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLND_IDILO (Q5QXT0) [Protein-PII] uridylyltransferase (EC 2.7.7.... | 28 | 4.9 | 2 | OMPB_NEISI (P30692) Major outer membrane protein P.IB precursor ... | 28 | 4.9 | 3 | GBX2_XENLA (Q91907) Homeobox protein GBX-2 (Gastrulation and bra... | 28 | 8.3 |
|---|
>GLND_IDILO (Q5QXT0) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 879 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 56 LPVPATXXPLGRRMTPRSXRTDVVERPS 139 +PVP+T PL RRM S T+V PS Sbjct: 775 IPVPSTKRPLSRRMKNFSVATEVTFIPS 802
>OMPB_NEISI (P30692) Major outer membrane protein P.IB precursor (Protein IB)| (PIB) (Porin) Length = 357 Score = 28.5 bits (62), Expect = 4.9 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -2 Query: 162 EFRKRVGCEGRSTTSVRXLRGVILLPSGXSVAGTGKGYXTRAR*LFIWGXF 10 +F R+G +G S L + + SVAGT KG+ TR + + G F Sbjct: 55 DFGSRIGFKGHEHLS-NNLNAIWQVEQNTSVAGTDKGWGTRESFIGLEGGF 104
>GBX2_XENLA (Q91907) Homeobox protein GBX-2 (Gastrulation and brain-specific| homeobox protein 2) (XGBX-2) Length = 340 Score = 27.7 bits (60), Expect = 8.3 Identities = 19/53 (35%), Positives = 22/53 (41%) Frame = +1 Query: 4 EEEATPNEQSTRSRXVTFTCTCN*XXAWKKNDSAKXTNRRSRTALTSDTLAEL 162 +EE TP E S N S+ NRR RTA TS+ L EL Sbjct: 213 KEEDTPEESPQNSNPSN-----------NSNTSSTGKNRRRRTAFTSEQLLEL 254 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,950,184 Number of Sequences: 219361 Number of extensions: 255022 Number of successful extensions: 411 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)