Clone Name | rbasda22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RAB36_HUMAN (O95755) Ras-related protein Rab-36 | 30 | 5.4 | 2 | CP1A1_RABIT (P05176) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1)... | 30 | 9.1 |
---|
>RAB36_HUMAN (O95755) Ras-related protein Rab-36| Length = 333 Score = 30.4 bits (67), Expect = 5.4 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -1 Query: 489 SWTLGRVGRSASRRAPTYSTLRPASRS 409 SW LGR S ++ PT ST+R A RS Sbjct: 7 SWMLGRAAASPTQTPPTTSTIRVARRS 33
>CP1A1_RABIT (P05176) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1) (P450 isozyme| 6) (P-450 PHPAH1) (P450 LM6) Length = 518 Score = 29.6 bits (65), Expect = 9.1 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +1 Query: 268 RSRRPTQ*DRNPMMLSHANVSRAMACFEHSNFFKVTMPKTRPGQLRLGARCRPKGR 435 R+RRP DR + A + M F H++F T+P + LG PKGR Sbjct: 357 RARRPRFSDRPQLPYLEAVI---METFRHTSFLPFTIPHSTTRDTSLGGFYIPKGR 409 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,563,537 Number of Sequences: 219361 Number of extensions: 1962845 Number of successful extensions: 4680 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4679 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)