Clone Name | rbasd3n12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YKQ0_CAEEL (P34305) Putative ATP-dependent RNA helicase C06E1.10... | 31 | 4.1 | 2 | ADEN_ADEB4 (O71150) Adenain (EC 3.4.22.39) (Endoprotease) (Late ... | 30 | 7.0 | 3 | PA2D_AGKRH (Q9PVF4) Phospholipase A2 W6D49 precursor (EC 3.1.1.4... | 30 | 9.1 |
---|
>YKQ0_CAEEL (P34305) Putative ATP-dependent RNA helicase C06E1.10 in chromosome| III (EC 3.6.1.-) Length = 1148 Score = 30.8 bits (68), Expect = 4.1 Identities = 25/62 (40%), Positives = 32/62 (51%), Gaps = 9/62 (14%) Frame = -1 Query: 268 RWHDSVVGTSR--VPRLSALHQDRRNRKSFRSGIDSCNHGYHLYRS--YQ-----CDPAV 116 R +DS+ G SR V R+S D+R + R+G S H Y LY S YQ DP + Sbjct: 631 RLYDSITGVSRFAVCRISQASGDQR---AGRAGRISAGHAYRLYSSAVYQDFVKFADPEI 687 Query: 115 LS 110 LS Sbjct: 688 LS 689
>ADEN_ADEB4 (O71150) Adenain (EC 3.4.22.39) (Endoprotease) (Late L3 23 kDa| protein) Length = 201 Score = 30.0 bits (66), Expect = 7.0 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 575 RNLNDASPAQRPCDPSSYHESSD 643 ++LN ASP+ P DPSS H++ D Sbjct: 147 QSLNGASPSLTPSDPSSLHKNQD 169
>PA2D_AGKRH (Q9PVF4) Phospholipase A2 W6D49 precursor (EC 3.1.1.4)| (Phosphatidylcholine 2-acylhydrolase) Length = 137 Score = 29.6 bits (65), Expect = 9.1 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 6/68 (8%) Frame = +1 Query: 46 LTG*CTTRSLFIYLHSGVALGNSEQQDHIDNCDTDDSHGCNYRSLI------ESFSYSSG 207 +TG T++ +Y + + + +D D C D H C Y+ L ES+SY Sbjct: 28 MTGKEATKNYGMYGCNCGPMKRGKPKDATDQCCAD--HDCCYKKLTDCDPKKESYSYKFE 85 Query: 208 PGEVLKGE 231 GE+L GE Sbjct: 86 KGEILCGE 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,965,387 Number of Sequences: 219361 Number of extensions: 1788728 Number of successful extensions: 3929 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3928 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)