ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd3n05 |
|---|---|
| Clone Library Name | barley_pub |
>PSA5_ORYSA (Q9LSU1) Proteasome subunit alpha type 5 (EC 3.4.25.1) (20S| proteasome alpha subunit E) (20S proteasome subunit alpha-5) Length = 237 Score = 39.3 bits (90), Expect(3) = 8e-10 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 411 ETIALSILKQVMEEKVTPN 355 ETIALSILKQVMEEKVTPN Sbjct: 193 ETIALSILKQVMEEKVTPN 211 Score = 38.1 bits (87), Expect(3) = 8e-10 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 325 NYHLYTPAEVEAVIARL 275 NYHLYTPAEVEAVIARL Sbjct: 221 NYHLYTPAEVEAVIARL 237 Score = 23.1 bits (48), Expect(3) = 8e-10 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 359 PTNVDIAKVAP 327 P NVDIAKV+P Sbjct: 210 PNNVDIAKVSP 220
>PSA5_SOYBN (Q9M4T8) Proteasome subunit alpha type 5 (EC 3.4.25.1) (20S| proteasome alpha subunit E) (20S proteasome subunit alpha-5) Length = 237 Score = 39.3 bits (90), Expect(3) = 8e-09 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 411 ETIALSILKQVMEEKVTPN 355 ETIALSILKQVMEEKVTPN Sbjct: 193 ETIALSILKQVMEEKVTPN 211 Score = 33.5 bits (75), Expect(3) = 8e-09 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -2 Query: 322 YHLYTPAEVEAVIARL 275 YHLYTP+EVEAVI+RL Sbjct: 222 YHLYTPSEVEAVISRL 237 Score = 24.3 bits (51), Expect(3) = 8e-09 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 359 PTNVDIAKVAP 327 P NVDIAKVAP Sbjct: 210 PNNVDIAKVAP 220
>PSA5A_ARATH (O81149) Proteasome subunit alpha type 5-A (EC 3.4.25.1) (20S| proteasome alpha subunit E-1) Length = 237 Score = 38.1 bits (87), Expect(3) = 1e-08 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -3 Query: 411 ETIALSILKQVMEEKVTPN 355 ETIA+SILKQVMEEKVTPN Sbjct: 193 ETIAVSILKQVMEEKVTPN 211 Score = 33.9 bits (76), Expect(3) = 1e-08 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 322 YHLYTPAEVEAVIARL 275 YHLYTP EVEAVIARL Sbjct: 222 YHLYTPQEVEAVIARL 237 Score = 24.3 bits (51), Expect(3) = 1e-08 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 359 PTNVDIAKVAP 327 P NVDIAKVAP Sbjct: 210 PNNVDIAKVAP 220
>PSA5B_ARATH (Q42134) Proteasome subunit alpha type 5-B (EC 3.4.25.1) (20S| proteasome alpha subunit E-2) (Proteasome component Z) Length = 237 Score = 38.1 bits (87), Expect(3) = 3e-08 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -3 Query: 411 ETIALSILKQVMEEKVTPN 355 ETIA+SILKQVMEEKVTPN Sbjct: 193 ETIAVSILKQVMEEKVTPN 211 Score = 32.7 bits (73), Expect(3) = 3e-08 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 322 YHLYTPAEVEAVIARL 275 YHLYTP EVEAVI+RL Sbjct: 222 YHLYTPQEVEAVISRL 237 Score = 24.3 bits (51), Expect(3) = 3e-08 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 359 PTNVDIAKVAP 327 P NVDIAKVAP Sbjct: 210 PNNVDIAKVAP 220
>CATC_PLAF7 (Q8IIJ9) Probable cathepsin C precursor (EC 3.4.22.-)| Length = 700 Score = 28.1 bits (61), Expect = 8.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 209 SDTQQKGTYES*LTFDKDFRFSQSCYDCFDLCRGVKVVVS 328 S +Q G E + KDF + CY C + C G K++++ Sbjct: 529 SSQEQHGISEENRWYAKDFNYVGGCYGC-NQCNGEKIMMN 567
>LPIN1_MOUSE (Q91ZP3) Lipin-1 (Fatty liver dystrophy protein)| Length = 924 Score = 28.1 bits (61), Expect = 8.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 255 SNVNQDSYVPFCCVSDILMPLI*QKHNCSMIWTLMFASF 139 + N SYV C V D + PL+ + H+C + F++F Sbjct: 866 AKTNISSYVRLCEVVDHVFPLLKRSHSCDFPCSDTFSNF 904 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,787,552 Number of Sequences: 219361 Number of extensions: 1040478 Number of successful extensions: 1936 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1936 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
