| Clone Name | rbasd3m07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LAMA2_HUMAN (P24043) Laminin alpha-2 chain precursor (Laminin M ... | 30 | 4.5 | 2 | PSTB_PHOPR (Q6LU82) Phosphate import ATP-binding protein pstB (E... | 30 | 5.8 | 3 | OL470_MOUSE (Q8VF65) Olfactory receptor 470 (Olfactory receptor ... | 30 | 7.6 | 4 | PRAX_MOUSE (O55103) Periaxin | 29 | 10.0 | 5 | PRAX_RAT (Q63425) Periaxin | 29 | 10.0 | 6 | UACA_MOUSE (Q8CGB3) Uveal autoantigen with coiled-coil domains a... | 29 | 10.0 |
|---|
>LAMA2_HUMAN (P24043) Laminin alpha-2 chain precursor (Laminin M chain) (Merosin| heavy chain) Length = 3110 Score = 30.4 bits (67), Expect = 4.5 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = -2 Query: 458 KYLYKKIRGERGKEMADLEKTLTRCVNRIDEKIEGIREAGGFCPNRPKLFDSVPK---PL 288 K L+ + RGE + DL + L N++D+ + +REA +LF K L Sbjct: 1755 KKLFGESRGENEEMEKDLREKLADYKNKVDDAWDLLREATDKIREANRLFAVNQKNMTAL 1814 Query: 287 KQQKEKVKSG 258 +++KE V+SG Sbjct: 1815 EKKKEAVESG 1824
>PSTB_PHOPR (Q6LU82) Phosphate import ATP-binding protein pstB (EC 3.6.3.27)| (Phosphate-transporting ATPase) (ABC phosphate transporter) Length = 272 Score = 30.0 bits (66), Expect = 5.8 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 404 EKTLTRCVNRIDEKIEGIREAGGFCPNRPKLFDS 303 + TL RC+NR++E ++G R G + ++DS Sbjct: 64 KSTLLRCINRMNELVDGCRVDGKIMLHGQNIYDS 97
>OL470_MOUSE (Q8VF65) Olfactory receptor 470 (Olfactory receptor 204-22)| Length = 314 Score = 29.6 bits (65), Expect = 7.6 Identities = 19/69 (27%), Positives = 32/69 (46%) Frame = +2 Query: 92 LYFYCLYPLPYHYAQAPVLLLLISITMHKRLYFYCFHFPPHIFACQWKYSSKITSLQI*P 271 + F C+Y + + +LL+ +S +H +YF F H+ + YSS +T + Sbjct: 32 IIFLCIYLVNVSGNLSTILLIRVSSQLHHPMYF----FLSHLASVDVGYSSTVTPKMLAN 87 Query: 272 FLSAASRAS 298 FL S S Sbjct: 88 FLLERSTIS 96
>PRAX_MOUSE (O55103) Periaxin| Length = 1391 Score = 29.3 bits (64), Expect = 10.0 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -2 Query: 293 PLKQQKEKVKSGVK*SLRNISTDMQKCGEGNES 195 P Q+ EKV SGVK S +ST Q EG ES Sbjct: 1050 PGAQETEKVTSGVKPSGLQVSTTGQVVAEGQES 1082
>PRAX_RAT (Q63425) Periaxin| Length = 1383 Score = 29.3 bits (64), Expect = 10.0 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = -2 Query: 293 PLKQQKEKVKSGVK*SLRNISTDMQKCGEGNESSK 189 P Q+ EKV SGVK S +ST Q EG E ++ Sbjct: 1042 PGAQETEKVTSGVKPSGLQVSTTRQVVAEGQEGAQ 1076
>UACA_MOUSE (Q8CGB3) Uveal autoantigen with coiled-coil domains and ankyrin| repeats protein (Nucling) (Nuclear membrane-binding protein) Length = 1411 Score = 29.3 bits (64), Expect = 10.0 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 9/112 (8%) Frame = -2 Query: 494 VDSYNTMMPLRQKYLYKKIRGERGKEMADLEKTLTRCVNRIDEKIEGIREAGGFCPNRPK 315 V+ +PLR + ++++ + DL K L+ R EK + EA K Sbjct: 740 VEMKTRYVPLR---VSEEMKRSHDVNVEDLNKKLSEATQRYAEKKQ---EAERLLAENDK 793 Query: 314 LFDSVPK-------PLKQQKEKV--KSGVK*SLRNISTDMQKCGEGNESSKS 186 L +V + P K +KE + KS + + +S +KCGEG E ++ Sbjct: 794 LTKNVSRLEAVFVAPEKHEKELMGLKSNIAELKKQLSELNKKCGEGQEKIRA 845 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,263,376 Number of Sequences: 219361 Number of extensions: 1941588 Number of successful extensions: 5376 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5374 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)