Clone Name | rbasd3m03 |
---|---|
Clone Library Name | barley_pub |
>NBR1_PONPY (Q5RC94) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 894 Score = 34.3 bits (77), Expect = 0.39 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = -1 Query: 377 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 255 L+A L EMGF DR+ N +LL K+ +I + V +L+ D Sbjct: 848 LMAHLFEMGFCDRQLNLQLLKKHNYNILQVVTELLQLNNND 888
>DSK2_SCHPO (Q10169) Deubiquitination-protection protein dph1| Length = 354 Score = 33.9 bits (76), Expect = 0.51 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = -1 Query: 374 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIA 270 L++L+EMGF D E N + L ++GG+++ A+ L++ Sbjct: 318 LSQLNEMGFVDFERNVQALRRSGGNVQGAIESLLS 352
>UBQL2_MOUSE (Q9QZM0) Ubiquilin-2 (Protein linking IAP with cytoskeleton 2)| (PLIC-2) (Ubiquitin-like product Chap1/Dsk2) (DSK2 homolog) (Chap1) Length = 638 Score = 33.9 bits (76), Expect = 0.51 Identities = 33/131 (25%), Positives = 49/131 (37%), Gaps = 9/131 (6%) Frame = -1 Query: 629 TTPAEVPTSLLTSIPVDLTVAATAPVDVASALLDIDRXXXXXXXXXXXEMGFKQVDLNKE 450 T PA P S T IP TV+++AP + S + Sbjct: 533 TGPASSPGSTGTGIPPATTVSSSAPTETISPTSESG------------------------ 568 Query: 449 ILRQNKYNLEQSVDDLCGVNEWDP---------LLAELSEMGFDDRETNKELLAKNGGSI 297 N+ ++Q V L G + P L +L+ MGF +RE N + L GG I Sbjct: 569 ---PNQQFIQQMVQALTGGSPPQPPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDI 625 Query: 296 KRAVMDLIARE 264 A+ L+ + Sbjct: 626 NAAIERLLGSQ 636
>NBR1_HUMAN (Q14596) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) (1A1-3B) Length = 966 Score = 33.5 bits (75), Expect = 0.66 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -1 Query: 377 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 255 L+A L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 920 LMARLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNND 960
>NBR1_RAT (Q501R9) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 983 Score = 33.5 bits (75), Expect = 0.66 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -1 Query: 377 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 255 L+A L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 937 LMAHLFEMGFCDRQLNLRLLRKHNHNILQVVTELLQVNNND 977
>NBR1_MOUSE (P97432) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) Length = 988 Score = 33.1 bits (74), Expect = 0.87 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -1 Query: 377 LLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 255 L+A L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 942 LMAHLFEMGFCDRQLNLRLLRKHNYNILQVVTELLQVNNND 982 Score = 29.6 bits (65), Expect = 9.6 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 482 MGFKQVDLNKEILRQNKYNLEQSVDDLCGVNEWD 381 MGF LN +LR++ YN+ Q V +L VN D Sbjct: 949 MGFCDRQLNLRLLRKHNYNILQVVTELLQVNNND 982
>UBQL1_HUMAN (Q9UMX0) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) (hPLIC-1) Length = 589 Score = 33.1 bits (74), Expect = 0.87 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -1 Query: 425 LEQSVDDLCGVN--------EWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIA 270 ++Q + L GVN + L +LS MGF +RE N + L GG I A+ L+ Sbjct: 526 IQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLG 585 Query: 269 RE 264 + Sbjct: 586 SQ 587
>UBQL1_RAT (Q9JJP9) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) Length = 582 Score = 33.1 bits (74), Expect = 0.87 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -1 Query: 425 LEQSVDDLCGVN--------EWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIA 270 ++Q + L GVN + L +LS MGF +RE N + L GG I A+ L+ Sbjct: 519 IQQMLQALAGVNPQLQSPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLG 578 Query: 269 RE 264 + Sbjct: 579 SQ 580
>UBQL1_MOUSE (Q8R317) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) Length = 582 Score = 33.1 bits (74), Expect = 0.87 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = -1 Query: 425 LEQSVDDLCGVN--------EWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIA 270 ++Q + L GVN + L +LS MGF +RE N + L GG I A+ L+ Sbjct: 519 IQQMLQALAGVNPQLQSPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLG 578 Query: 269 RE 264 + Sbjct: 579 SQ 580
>UBQL2_HUMAN (Q9UHD9) Ubiquilin-2 (Protein linking IAP with cytoskeleton 2)| (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) (DSK2 homolog) (Chap1) Length = 624 Score = 32.3 bits (72), Expect = 1.5 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 9/67 (13%) Frame = -1 Query: 437 NKYNLEQSVDDLCGVN---------EWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 285 N+ ++Q V L G N + L +L+ MGF +RE N + L GG I A+ Sbjct: 556 NQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAI 615 Query: 284 MDLIARE 264 L+ + Sbjct: 616 ERLLGSQ 622
>UBL7_MOUSE (Q91W67) Ubiquitin-like protein 7 (Ubiquitin-like protein SB132)| Length = 380 Score = 31.2 bits (69), Expect = 3.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 392 NEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 285 ++W P L +L +MG D E + L GG I+ A+ Sbjct: 336 SQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAAL 371
>UBL7_HUMAN (Q96S82) Ubiquitin-like protein 7 (Ubiquitin-like protein SB132)| (Bone marrow stromal cell ubiquitin-like protein) (BMSC-UbP) Length = 380 Score = 31.2 bits (69), Expect = 3.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 392 NEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAV 285 ++W P L +L +MG D E + L GG I+ A+ Sbjct: 336 SQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAAL 371
>UN13B_HUMAN (O14795) Unc-13 homolog B (Munc13-2) (munc13)| Length = 1591 Score = 30.8 bits (68), Expect = 4.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 46 GTEQLSRLQQPHAADPPRSQHNKVHTAHRSHT 141 G+ QLS L Q H D + + +H+ H SH+ Sbjct: 270 GSSQLSELDQYHEQDDDHRETDSIHSCHSSHS 301
>GTS1_YEAST (P40956) Protein GTS1 (Protein LSR1)| Length = 396 Score = 30.8 bits (68), Expect = 4.3 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 374 LAELSEMGFDDRETNKELLAKNGGSIKRAV 285 LAEL +MGF D N + L+ G+I RA+ Sbjct: 199 LAELKDMGFGDTNKNLDALSSAHGNINRAI 228
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 30.8 bits (68), Expect = 4.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 52 EQLSRLQQPHAADPPRSQHNKVHTAHRSHT 141 +Q S+LQ PH+ PP QH + H H+ T Sbjct: 406 QQHSQLQPPHSQHPPPHQHIQHHPNHQHQT 435
>UBQL4_HUMAN (Q9NRR5) Ubiquilin-4 (Ataxin-1 ubiquitin-like-interacting protein| A1U) Length = 601 Score = 30.4 bits (67), Expect = 5.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 374 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 264 L +L+ MGF +RE N + L GG I A+ L+ + Sbjct: 563 LEQLNSMGFINREANLQALIATGGDINAAIERLLGSQ 599
>UBQL4_MOUSE (Q99NB8) Ubiquilin-4 (Ataxin-1 ubiquitin-like-interacting protein| A1U) Length = 596 Score = 30.4 bits (67), Expect = 5.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 374 LAELSEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 264 L +L+ MGF +RE N + L GG I A+ L+ + Sbjct: 558 LEQLNSMGFINREANLQALIATGGDINAAIERLLGSQ 594
>SYM_STRR6 (P67581) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 665 Score = 30.4 bits (67), Expect = 5.6 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 461 LNKEILRQNKYNLEQSVDDLCGVNEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVM 282 LN+ + NKY Q + GV E+D +LAE++E D T+ E A + AV Sbjct: 369 LNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHME--AVDYPRALEAVW 426 Query: 281 DLIAREKK 258 LI+R K Sbjct: 427 TLISRTNK 434
>SYM_STRPN (P67580) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 665 Score = 30.4 bits (67), Expect = 5.6 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = -1 Query: 461 LNKEILRQNKYNLEQSVDDLCGVNEWDPLLAELSEMGFDDRETNKELLAKNGGSIKRAVM 282 LN+ + NKY Q + GV E+D +LAE++E D T+ E A + AV Sbjct: 369 LNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHME--AVDYPRALEAVW 426 Query: 281 DLIAREKK 258 LI+R K Sbjct: 427 TLISRTNK 434
>Y3539_METJA (Q60294) Hypothetical UPF0252 protein MJECL39| Length = 351 Score = 29.6 bits (65), Expect = 9.6 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 14/92 (15%) Frame = -2 Query: 241 ELSNTYLSISIYICLNNE-TVCPVVCL*TAVKTCWCD--FCVR-------CELYYVVTVV 92 E SN Y I+ +I + + P V L WC+ FC+ C LY+++T++ Sbjct: 51 EKSNVYYFITFFIIVGLVWAIFPEVWL-------WCEQVFCISPTIHIIICCLYFIITII 103 Query: 91 GQLRVVAVIG----LVALFLLFNYCEGRPMXL 8 L + V+G L A F + C+ + + L Sbjct: 104 LFLFLCGVVGTFLHLWATFFTLSKCDSKILKL 135
>UBIB_PSESM (Q87UZ0) Probable ubiquinone biosynthesis protein ubiB| Length = 539 Score = 29.6 bits (65), Expect = 9.6 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 58 LSRLQQPHAADPPRSQHNK 114 L R+ +PHA+DPPR H++ Sbjct: 468 LERMSRPHASDPPRPWHDR 486 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,334,419 Number of Sequences: 219361 Number of extensions: 1857261 Number of successful extensions: 5211 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 4977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5206 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7252940416 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)