Clone Name | rbasd3l05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MOAA_CORGL (Q8NR60) Molybdenum cofactor biosynthesis protein A | 32 | 1.6 |
---|
>MOAA_CORGL (Q8NR60) Molybdenum cofactor biosynthesis protein A| Length = 377 Score = 32.0 bits (71), Expect = 1.6 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -3 Query: 424 LPTEDLDALVSVTTNDDLGHLLEEYDAASRDRLQPLKIRAFLFP 293 L T D + VS+T D L +L DAA L P+KI A + P Sbjct: 165 LDTIDAERYVSLTRRDRLSGVLASIDAAVAAGLHPVKINAVVMP 208 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,598,444 Number of Sequences: 219361 Number of extensions: 1443382 Number of successful extensions: 4437 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4427 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)