Clone Name | rbasd3j22 |
---|---|
Clone Library Name | barley_pub |
>UBC3_SCHPO (P40984) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase hus5) (Ubiquitin carrier protein hus5) (SUMO protein ligase) (SUMO-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 157 Score = 58.9 bits (141), Expect(2) = 2e-14 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CLSILNE+ GW+PAIT+KQIL+GIQDLLD P Sbjct: 93 CLSILNEEEGWKPAITIKQILLGIQDLLDDP 123 Score = 37.7 bits (86), Expect(2) = 2e-14 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L +PN A PAQT+ Y +F +D EY +R+RA Sbjct: 120 LDDPNIASPAQTEAYTMFKKDKVEYEKRVRA 150
>UBE2I_XENLA (P63282) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 53.9 bits (128), Expect(2) = 4e-12 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CLSIL ED WRPAIT+KQIL+GIQ+LL++P Sbjct: 93 CLSILEEDKDWRPAITIKQILLGIQELLNEP 123 Score = 34.7 bits (78), Expect(2) = 4e-12 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PN DPAQ + Y ++ Q+ EY +R+RA Sbjct: 120 LNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA 150
>UBE2I_RAT (P63281) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin-conjugating enzyme UbcE2A) Length = 158 Score = 53.9 bits (128), Expect(2) = 4e-12 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CLSIL ED WRPAIT+KQIL+GIQ+LL++P Sbjct: 93 CLSILEEDKDWRPAITIKQILLGIQELLNEP 123 Score = 34.7 bits (78), Expect(2) = 4e-12 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PN DPAQ + Y ++ Q+ EY +R+RA Sbjct: 120 LNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA 150
>UBE2I_MOUSE (P63280) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (mUBC9) Length = 158 Score = 53.9 bits (128), Expect(2) = 4e-12 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CLSIL ED WRPAIT+KQIL+GIQ+LL++P Sbjct: 93 CLSILEEDKDWRPAITIKQILLGIQELLNEP 123 Score = 34.7 bits (78), Expect(2) = 4e-12 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PN DPAQ + Y ++ Q+ EY +R+RA Sbjct: 120 LNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA 150
>UBE2I_HUMAN (P63279) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (p18) Length = 158 Score = 53.9 bits (128), Expect(2) = 4e-12 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CLSIL ED WRPAIT+KQIL+GIQ+LL++P Sbjct: 93 CLSILEEDKDWRPAITIKQILLGIQELLNEP 123 Score = 34.7 bits (78), Expect(2) = 4e-12 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PN DPAQ + Y ++ Q+ EY +R+RA Sbjct: 120 LNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA 150
>UBE2I_CHICK (P63283) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 53.9 bits (128), Expect(2) = 4e-12 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CLSIL ED WRPAIT+KQIL+GIQ+LL++P Sbjct: 93 CLSILEEDKDWRPAITIKQILLGIQELLNEP 123 Score = 34.7 bits (78), Expect(2) = 4e-12 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PN DPAQ + Y ++ Q+ EY +R+RA Sbjct: 120 LNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA 150
>UBC9_YEAST (P50623) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 157 Score = 56.6 bits (135), Expect(2) = 7e-11 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CLSILNED WRPAIT+KQI++G+QDLLD P Sbjct: 93 CLSILNEDQDWRPAITLKQIVLGVQDLLDSP 123 Score = 27.7 bits (60), Expect(2) = 7e-11 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRI 203 L +PNP PAQ + F ++ AEY +++ Sbjct: 120 LDSPNPNSPAQEPAWRSFSRNKAEYDKKV 148
>UBC9_CAEEL (Q95017) Ubiquitin-conjugating enzyme E2 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) Length = 166 Score = 48.5 bits (114), Expect(2) = 2e-10 Identities = 18/31 (58%), Positives = 28/31 (90%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CLS+L+E+ W+P+I++KQ+L+GIQDLL+ P Sbjct: 93 CLSLLDENKDWKPSISIKQLLIGIQDLLNHP 123 Score = 34.7 bits (78), Expect(2) = 2e-10 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L +PN DPAQ + Y ++ Q+ AEY +R++ Sbjct: 120 LNHPNIEDPAQAEAYQIYCQNRAEYEKRVK 149
>UBE2I_MESAU (O09181) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 50.4 bits (119), Expect(2) = 3e-10 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CLSIL ED WRPAIT+ Q+ +GIQ+LL++P Sbjct: 93 CLSILEEDKDWRPAITINQLFIGIQELLNEP 123 Score = 32.0 bits (71), Expect(2) = 3e-10 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PN +PAQ + Y ++ Q+ EY +R RA Sbjct: 120 LNEPNIQEPAQAEAYTIYCQNRVEYEKRFRA 150
>UBE2B_RAT (P63149) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 30.0 bits (66), Expect(2) = 0.005 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL + W P V IL IQ LLD+P Sbjct: 88 CLDILQ--NRWSPTYDVSSILTSIQSLLDEP 116 Score = 27.3 bits (59), Expect(2) = 0.005 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PNP PA + L+ ++ EY +R+ A Sbjct: 113 LDEPNPNSPANSQAAQLYQENKREYEKRVSA 143
>UBE2B_RABIT (P63148) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 30.0 bits (66), Expect(2) = 0.005 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL + W P V IL IQ LLD+P Sbjct: 88 CLDILQ--NRWSPTYDVSSILTSIQSLLDEP 116 Score = 27.3 bits (59), Expect(2) = 0.005 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PNP PA + L+ ++ EY +R+ A Sbjct: 113 LDEPNPNSPANSQAAQLYQENKREYEKRVSA 143
>UBE2B_MOUSE (P63147) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) Length = 152 Score = 30.0 bits (66), Expect(2) = 0.005 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL + W P V IL IQ LLD+P Sbjct: 88 CLDILQ--NRWSPTYDVSSILTSIQSLLDEP 116 Score = 27.3 bits (59), Expect(2) = 0.005 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PNP PA + L+ ++ EY +R+ A Sbjct: 113 LDEPNPNSPANSQAAQLYQENKREYEKRVSA 143
>UBE2B_HUMAN (P63146) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) Length = 152 Score = 30.0 bits (66), Expect(2) = 0.005 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL + W P V IL IQ LLD+P Sbjct: 88 CLDILQ--NRWSPTYDVSSILTSIQSLLDEP 116 Score = 27.3 bits (59), Expect(2) = 0.005 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PNP PA + L+ ++ EY +R+ A Sbjct: 113 LDEPNPNSPANSQAAQLYQENKREYEKRVSA 143
>UBE2A_MOUSE (Q9Z255) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (mHR6A) Length = 152 Score = 30.0 bits (66), Expect(2) = 0.005 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL + W P V IL IQ LLD+P Sbjct: 88 CLDILQ--NRWSPTYDVSSILTSIQSLLDEP 116 Score = 27.3 bits (59), Expect(2) = 0.005 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PNP PA + L+ ++ EY +R+ A Sbjct: 113 LDEPNPNSPANSQAAQLYQENKREYEKRVSA 143
>UBE2A_HUMAN (P49459) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (hHR6A) Length = 152 Score = 30.0 bits (66), Expect(2) = 0.005 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL + W P V IL IQ LLD+P Sbjct: 88 CLDILQ--NRWSPTYDVSSILTSIQSLLDEP 116 Score = 27.3 bits (59), Expect(2) = 0.005 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L PNP PA + L+ ++ EY +R+ A Sbjct: 113 LDEPNPNSPANSQAAQLYQENKREYEKRVSA 143
>UBC12_YARLI (Q6C9W0) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 179 Score = 32.0 bits (71), Expect(2) = 0.008 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS 270 CL+IL ED W+P +++ +++G+Q L +P +S Sbjct: 106 CLNILRED--WKPVLSLNAVMIGLQYLFLEPNAS 137 Score = 24.6 bits (52), Expect(2) = 0.008 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 286 INPNPADPAQTDGYHLFIQDPAEYRRRIR 200 + PN +DP D H + E++R ++ Sbjct: 132 LEPNASDPLNKDAAHQMTANREEFKRNVK 160
>UBC12_KLULA (Q6CSW8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 31.6 bits (70), Expect(2) = 0.023 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL++L ED W PA+ ++ I++GI L +P Sbjct: 112 CLNLLRED--WTPALDIQSIIIGILFLFHEP 140 Score = 23.5 bits (49), Expect(2) = 0.023 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = -1 Query: 280 PNPADPAQTDGYHLFIQDPAEYRRRI 203 PN DP D I+DP + ++ Sbjct: 140 PNGRDPLNKDAAKTLIEDPLRFENKV 165
>UBC_MIMIV (Q5UQC9) Probable ubiquitin-conjugating enzyme E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 158 Score = 28.9 bits (63), Expect(2) = 0.030 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL+IL +D GW ++ + I+ I LLDQP Sbjct: 91 CLNILKKD-GWNASLNIISIIWSIIVLLDQP 120 Score = 25.8 bits (55), Expect(2) = 0.030 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 295 ICLINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 + L PNP DP ++ L+ D Y ++IR Sbjct: 115 VLLDQPNPEDPFNSELASLYRNDKLSYDKKIR 146
>UB2D1_MOUSE (P61080) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 29.3 bits (64), Expect(2) = 0.031 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL S W PA+TV ++L+ I LL P Sbjct: 85 CLDILR--SQWSPALTVSKVLLSICSLLCDP 113 Score = 25.4 bits (54), Expect(2) = 0.031 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L +PNP DP D ++ D +Y R R Sbjct: 110 LCDPNPDDPLVPDIAQIYKSDKEKYNRHAR 139
>UB2D1_HUMAN (P51668) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (UbcH5) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 29.3 bits (64), Expect(2) = 0.031 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL S W PA+TV ++L+ I LL P Sbjct: 85 CLDILR--SQWSPALTVSKVLLSICSLLCDP 113 Score = 25.4 bits (54), Expect(2) = 0.031 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L +PNP DP D ++ D +Y R R Sbjct: 110 LCDPNPDDPLVPDIAQIYKSDKEKYNRHAR 139
>UBC1_CAEEL (P52478) Ubiquitin-conjugating enzyme E2 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 192 Score = 29.3 bits (64), Expect(2) = 0.049 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL + W P V IL IQ LLD+P Sbjct: 88 CLDILQ--NRWSPTYDVAAILTSIQSLLDEP 116 Score = 24.6 bits (52), Expect(2) = 0.049 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L PNP PA + L+ ++ EY +R++ Sbjct: 113 LDEPNPNSPANSLAAQLYQENRREYEKRVQ 142
>UBC12_SCHPO (O74549) NEDD8-conjugating enzyme ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 177 Score = 30.4 bits (67), Expect(2) = 0.14 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL+IL +D W P + + ILVG+Q L P Sbjct: 105 CLNILRQD--WNPVLNLNSILVGLQFLFLSP 133 Score = 21.9 bits (45), Expect(2) = 0.14 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -1 Query: 286 INPNPADPAQTDGYHLFIQDPAEYRRRIRAA 194 ++PN DP + +DP + R+R A Sbjct: 131 LSPNAEDPLNKEAAADLHKDPQGFASRVRTA 161
>UBC2_CRYNE (Q5KN22) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 169 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L +PNPA PA D LF ++ EY RR++ Sbjct: 113 LNDPNPASPANVDAAQLFKENLKEYERRVK 142
>UBC12_XENTR (Q6P8D9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL+IL ED W+P +T+ I+ G+Q L +P Sbjct: 111 CLNILRED--WKPVLTINSIIYGLQYLFLEP 139
>UBC12_XENLA (Q6DCZ9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL+IL ED W+P +T+ I+ G+Q L +P Sbjct: 111 CLNILRED--WKPVLTINSIIYGLQYLFLEP 139
>UBC12_MOUSE (P61082) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL+IL ED W+P +T+ I+ G+Q L +P Sbjct: 111 CLNILRED--WKPVLTINSIIYGLQYLFLEP 139
>UBC12_HUMAN (P61081) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL+IL ED W+P +T+ I+ G+Q L +P Sbjct: 111 CLNILRED--WKPVLTINSIIYGLQYLFLEP 139
>UBC2_MEDSA (P35130) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 32.0 bits (71), Expect = 0.38 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L +PNP PA ++ +F ++ EY RR+R Sbjct: 113 LCDPNPNSPANSEAARMFSENKREYNRRVR 142
>UBC2_ARATH (P42745) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) Length = 152 Score = 31.6 bits (70), Expect = 0.49 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L +PNP PA ++ +F + EY RR+R Sbjct: 113 LCDPNPNSPANSEAARMFSESKREYNRRVR 142
>UBC1_ARATH (P25865) Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 152 Score = 30.4 bits (67), Expect = 1.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L +PNP PA ++ ++ + EY RR+R Sbjct: 113 LCDPNPNSPANSEAARMYSESKREYNRRVR 142
>UBC12_DROME (Q9VSF3) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-) (NEDD8 protein| ligase) (NEDD8 carrier protein) Length = 181 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL+IL ED W P + + I+ G+Q L +P Sbjct: 108 CLNILRED--WNPVLNINSIVYGLQFLFLEP 136
>UBE2H_MOUSE (P62257) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) Length = 183 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L PNP DP D +++ P EY+++I+ Sbjct: 113 LAYPNPIDPLNGDAAAMYLHRPEEYKQKIK 142
>UBE2H_HUMAN (P62256) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UbcH2) (E2-20K) Length = 183 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L PNP DP D +++ P EY+++I+ Sbjct: 113 LAYPNPIDPLNGDAAAMYLHRPEEYKQKIK 142
>UB2D4_RAT (P70711) Ubiquitin-conjugating enzyme E2 D4 (EC 6.3.2.19)| (Ubiquitin-protein ligase D4) (Ubiquitin carrier protein D4) (Ubiquitin-conjugating enzyme E2-17 kDa 4) (E2(17)KB 4) Length = 147 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL IL S W PA+T+ ++L+ I LL P Sbjct: 85 CLDILR--SQWSPALTISKVLLSISSLLCDP 113
>UBC2_WHEAT (P25866) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L +PNP PA ++ ++ ++ EY R++R Sbjct: 113 LCDPNPNSPANSEAARMYSENKREYNRKVR 142
>UBCD1_DROME (P25867) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) Length = 147 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGSSRV 216 CL IL S W PA+T+ ++L+ I LL P PD PL P +R+ Sbjct: 85 CLDILR--SQWSPALTISKVLLSICSLLCDP-----NPD---DPLVPEIARI 126
>UBC2_CAEEL (P35129) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) (Lethal protein 70) Length = 147 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGSSRV 216 CL IL S W PA+T+ ++L+ I LL P PD PL P +R+ Sbjct: 85 CLDILR--SQWSPALTISKVLLSICSLLCDP-----NPD---DPLVPEIARI 126
>UB2D3_RAT (P61078) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) (Phosphoarginine phosphatase) (PAPase) Length = 147 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGSSRV 216 CL IL S W PA+T+ ++L+ I LL P PD PL P +R+ Sbjct: 85 CLDILR--SQWSPALTISKVLLSICSLLCDP-----NPD---DPLVPEIARI 126
>UB2D3_MOUSE (P61079) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGSSRV 216 CL IL S W PA+T+ ++L+ I LL P PD PL P +R+ Sbjct: 85 CLDILR--SQWSPALTISKVLLSICSLLCDP-----NPD---DPLVPEIARI 126
>UB2D3_HUMAN (P61077) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGSSRV 216 CL IL S W PA+T+ ++L+ I LL P PD PL P +R+ Sbjct: 85 CLDILR--SQWSPALTISKVLLSICSLLCDP-----NPD---DPLVPEIARI 126
>UB2D2_XENLA (P62840) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Xubc4) Length = 147 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGSSRV 216 CL IL S W PA+T+ ++L+ I LL P PD PL P +R+ Sbjct: 85 CLDILR--SQWSPALTISKVLLSICSLLCDP-----NPD---DPLVPEIARI 126
>UB2D2_RAT (P62839) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGSSRV 216 CL IL S W PA+T+ ++L+ I LL P PD PL P +R+ Sbjct: 85 CLDILR--SQWSPALTISKVLLSICSLLCDP-----NPD---DPLVPEIARI 126
>UB2D2_MOUSE (P62838) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGSSRV 216 CL IL S W PA+T+ ++L+ I LL P PD PL P +R+ Sbjct: 85 CLDILR--SQWSPALTISKVLLSICSLLCDP-----NPD---DPLVPEIARI 126
>UB2D2_HUMAN (P62837) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGSSRV 216 CL IL S W PA+T+ ++L+ I LL P PD PL P +R+ Sbjct: 85 CLDILR--SQWSPALTISKVLLSICSLLCDP-----NPD---DPLVPEIARI 126
>UBE2T_XENLA (Q7ZY08) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 192 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -3 Query: 371 CLSILN--EDSGWRPAITVKQILVGIQDLLDQP 279 CL IL WRPA+ + +L IQ L+ +P Sbjct: 86 CLDILKLPPKGAWRPALNISTVLTSIQLLMSEP 118
>UBC3_ARATH (P42746) Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 3) (Ubiquitin carrier protein 3) Length = 150 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRI 203 L +PNP PA + LF ++ EY R++ Sbjct: 113 LCDPNPDSPANAEAARLFSENKREYNRKV 141
>UBCD6_DROME (P25153) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 28.5 bits (62), Expect = 4.2 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L +PNP PA + L+ ++ EY +R++A Sbjct: 113 LSDPNPNSPANSTAAQLYKENRREYEKRVKA 143
>UBC13_YEAST (P52490) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 153 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 371 CLSILNEDSGWRPAITVKQILVGIQDLLDQP 279 CL +L + W PA+ ++ +L+ IQ LL P Sbjct: 87 CLDVLK--TNWSPALQIRTVLLSIQALLASP 115
>UBC2_USTMA (Q4PFA5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 185 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIRA 197 L +PNP PA + L+ ++ EY RR++A Sbjct: 113 LHDPNPNSPANAEAASLYRENMKEYVRRVKA 143
>UBC15_SCHPO (Q9Y818) Ubiquitin-conjugating enzyme E2 15 (EC 6.3.2.19)| (Ubiquitin-protein ligase 15) (Ubiquitin carrier protein 15) Length = 167 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L +PN PA D F ++P E+++R+R Sbjct: 128 LSSPNDESPANIDAAKEFRENPQEFKKRVR 157
>ANKK1_HUMAN (Q8NFD2) Ankyrin repeat and protein kinase domain-containing| protein 1 (EC 2.7.11.1) (Protein kinase PKK2) (X-kinase) (SgK288) Length = 765 Score = 28.1 bits (61), Expect = 5.4 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +2 Query: 86 TPLWAIISQTSYFQVR*FMILDCYADPQTRAGY--CLACSPNTPPILCWIL 232 TPL +++Q S QVR + + D QT +GY L + + P LC +L Sbjct: 364 TPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALL 414
>CYSB_SALTY (P06614) HTH-type transcriptional regulator cysB (Cys regulon| transcriptional activator) Length = 324 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +1 Query: 31 TPDH-MSQMSTVTIESSPQYPALGYN*SNFIFSG 129 TPDH ++ S+VTIE+ QYP + Y F F+G Sbjct: 173 TPDHPLAATSSVTIEALAQYPLVTY---TFGFTG 203
>EBM_LILLO (Q5H7P5) Mannosylglycoprotein endo-beta-mannosidase (EC 3.2.1.152)| (Endo-beta-mannosidase) [Contains: Mannosylglycoprotein endo-beta-mannosidase 31 kDa subunit; Mannosylglycoprotein endo-beta-mannosidase 28 kDa subunit; Mannosylglycoprotein end Length = 952 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 350 DSGWRPAITVKQILVGIQDLLDQP*SS*SCPD*WLSPLYPGS 225 DSGW A + + L G+Q +P S S P W+ + PG+ Sbjct: 6 DSGWLAARSTELELTGVQLTTTRPPSGTSAP--WIEAVVPGT 45
>Y3064_XANAC (Q8PI34) UPF0060 membrane protein XAC3064| Length = 111 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 251 WLSPLYP-GSSRV*EAYSGCRLSSTLLW 171 WL L+P S RV AY G ++S LLW Sbjct: 50 WLLSLHPEASGRVYAAYGGVYIASALLW 77
>DNAJ_LACLC (Q93Q66) Chaperone protein dnaJ| Length = 379 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 26 GQHRTTCHKC-PRSQ*KAPHNTPLWAIISQTS 118 G H TCHKC R Q +TPL + +QT+ Sbjct: 165 GTHPETCHKCGGRGQINVVRDTPLGRMQTQTT 196
>GCSP_SYNY3 (P74416) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 983 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/64 (28%), Positives = 28/64 (43%) Frame = +1 Query: 40 HMSQMSTVTIESSPQYPALGYN*SNFIFSGAVIYDFRLLRGSSNQSRVLLSLQPEYASYT 219 H ST + QYPA + +YD+R ++Q + L++L + S T Sbjct: 222 HTFSFSTSIFGALLQYPA----------TDGAVYDYRSFIDKAHQHQALVTLAADPLSLT 271 Query: 220 LLDP 231 LL P Sbjct: 272 LLTP 275
>UBC17_CAEEL (Q11076) Probable ubiquitin-conjugating enzyme protein 17| Length = 679 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -3 Query: 371 CLSILNEDSG-----WRPAITVKQILVGIQDLLDQ 282 CLSIL G W P ++ Q+LV IQ+++++ Sbjct: 502 CLSILGTWEGRPEEKWNPYCSLMQVLVSIQEVIEK 536
>DIDH_RAT (P23457) 3-alpha-hydroxysteroid dehydrogenase (EC 1.1.1.213)| (3-alpha-HSD) (Hydroxyprostaglandin dehydrogenase) Length = 322 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 80 GELSIVTVDICDMWSGVDQTK 18 G+L TVDICD W +++ K Sbjct: 135 GKLLFETVDICDTWEAMEKCK 155
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L+ PNP+DP + L ++D Y +R++ Sbjct: 111 LLYPNPSDPLNGEAAALMMRDRPAYEQRVK 140
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 289 LINPNPADPAQTDGYHLFIQDPAEYRRRIR 200 L+ PNP+DP + L ++D Y +R++ Sbjct: 111 LLYPNPSDPLNGEAAALMMRDRPTYEQRVK 140
>Y2880_XANCP (Q8P6T5) UPF0060 membrane protein XCC2880| Length = 111 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 251 WLSPLYPGSS-RV*EAYSGCRLSSTLLW 171 WL L+P +S RV AY G +++ LLW Sbjct: 50 WLLTLHPAASGRVYAAYGGVYIATALLW 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,172,730 Number of Sequences: 219361 Number of extensions: 1162029 Number of successful extensions: 2275 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 2201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2275 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)