| Clone Name | rbasd3h16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LHX8_MOUSE (O35652) LIM/homeobox protein Lhx8 (LIM homeodomain L... | 33 | 0.22 | 2 | ADA19_HUMAN (Q9H013) ADAM 19 precursor (EC 3.4.24.-) (A disinteg... | 30 | 1.1 | 3 | ADA19_MOUSE (O35674) ADAM 19 precursor (EC 3.4.24.-) (A disinteg... | 28 | 5.4 |
|---|
>LHX8_MOUSE (O35652) LIM/homeobox protein Lhx8 (LIM homeodomain Lhx7) (L3)| Length = 367 Score = 32.7 bits (73), Expect = 0.22 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +3 Query: 99 SSCGKHT*QTNLLKEGKGTEFHGALF*ERHRQSCCYCKLLVFYSHAFAVIASKTYTRAY 275 S CG+H T+ ++ KG +H A F +C CK + FA++ K R + Sbjct: 158 SRCGRHIHSTDWVRRAKGNVYHLACF------ACFSCKRQLSTGEEFALVEEKVLCRVH 210
>ADA19_HUMAN (Q9H013) ADAM 19 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 19) (Meltrin beta) (Metalloprotease and disintegrin dentritic antigen marker) (MADDAM) Length = 956 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +1 Query: 142 KEKEQSSMELSSRRGIANHAATASYWSFILTPLPS*LARRIRGRIYRSVYTR 297 +E E SS+ LS+ RGI +S S+++ PLP + + IYRS + + Sbjct: 121 RETELSSVTLSTCRGIRGLITVSSNLSYVIEPLPDSKGQHL---IYRSEHLK 169
>ADA19_MOUSE (O35674) ADAM 19 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 19) (Meltrin beta) Length = 920 Score = 28.1 bits (61), Expect = 5.4 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +1 Query: 142 KEKEQSSMELSSRRGIANHAATASYWSFILTPLPS*LARRIRGRIYRS 285 ++ ++SS+ LS+ RGI S S+I+ P+P+ + RIYRS Sbjct: 121 RDVDESSVTLSTCRGIRGLIIVRSNLSYIIEPVPN---SDSQHRIYRS 165 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,401,121 Number of Sequences: 219361 Number of extensions: 724318 Number of successful extensions: 1178 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1178 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)