| Clone Name | rbasd2p24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AUXI_BOVIN (Q27974) Auxilin | 30 | 4.0 | 2 | PDLI7_CHICK (Q679P3) PDZ and LIM domain protein 7 (LIM mineraliz... | 29 | 6.8 |
|---|
>AUXI_BOVIN (Q27974) Auxilin| Length = 910 Score = 29.6 bits (65), Expect = 4.0 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 35 YTPIITHDEVHEYRTGHG--YMNISHTHTGRQVLIMYHLRST 154 YT + + EYR G ++ +S T G V+ MYHLRST Sbjct: 262 YTTCADFERMKEYRVQDGKIFIPLSITVQGDVVVSMYHLRST 303
>PDLI7_CHICK (Q679P3) PDZ and LIM domain protein 7 (LIM mineralization protein)| Length = 416 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 359 SPGAPSSRRPGLAPRPPSGT 418 SPGA PGLAPR P+ T Sbjct: 159 SPGAAMKTEPGLAPRTPAAT 178 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,939,044 Number of Sequences: 219361 Number of extensions: 1108294 Number of successful extensions: 3316 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3315 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)