Clone Name | rbasd2o22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SMAD7_RAT (O88406) Mothers against decapentaplegic homolog 7 (SM... | 30 | 7.9 | 2 | SMAD7_MOUSE (O35253) Mothers against decapentaplegic homolog 7 (... | 30 | 7.9 | 3 | SMAD7_HUMAN (O15105) Mothers against decapentaplegic homolog 7 (... | 30 | 7.9 |
---|
>SMAD7_RAT (O88406) Mothers against decapentaplegic homolog 7 (SMAD 7)| (Mothers against DPP homolog 7) (Smad7) Length = 426 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 208 PQINHQASLSRLACSSTYGMSRHSNVPCPPYARSRV 101 P + H + + RL C +YG V C P+ SR+ Sbjct: 166 PDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRL 201
>SMAD7_MOUSE (O35253) Mothers against decapentaplegic homolog 7 (SMAD 7)| (Mothers against DPP homolog 7) (Smad7) (Madh8) Length = 426 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 208 PQINHQASLSRLACSSTYGMSRHSNVPCPPYARSRV 101 P + H + + RL C +YG V C P+ SR+ Sbjct: 166 PDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRL 201
>SMAD7_HUMAN (O15105) Mothers against decapentaplegic homolog 7 (SMAD 7)| (Mothers against DPP homolog 7) (Smad7) (hSMAD7) Length = 426 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 208 PQINHQASLSRLACSSTYGMSRHSNVPCPPYARSRV 101 P + H + + RL C +YG V C P+ SR+ Sbjct: 166 PDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRL 201 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,008,171 Number of Sequences: 219361 Number of extensions: 1995760 Number of successful extensions: 5159 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5153 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)