ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd3d13 |
|---|---|
| Clone Library Name | barley_pub |
>YCF4_PSINU (Q8WI09) Photosystem I assembly protein ycf4| Length = 184 Score = 30.8 bits (68), Expect = 3.1 Identities = 30/87 (34%), Positives = 42/87 (48%), Gaps = 2/87 (2%) Frame = -2 Query: 461 LCLGG-GFLAVGAFIKLVRVVIAAPRQVDALMPRCPSQQMGLEAAGGVHCIYPGRGVSRF 285 L LG GFL VG+ L R L+P PSQQ+ G V C Y G+S Sbjct: 28 LILGALGFLLVGSSSYLGR----------DLIPLLPSQQIVFIPQGIVMCFYGIAGISIG 77 Query: 284 STPMVKKTW-VGDGYPHVFFCRRGVIR 207 +W +G+GY ++F +RG++R Sbjct: 78 FYLGFAISWDIGNGY-NLFDKQRGIVR 103
>PIP_NEIMB (Q9JZR6) Proline iminopeptidase (EC 3.4.11.5) (PIP) (Prolyl| aminopeptidase) (PAP) Length = 310 Score = 30.8 bits (68), Expect = 3.1 Identities = 27/72 (37%), Positives = 37/72 (51%), Gaps = 9/72 (12%) Frame = -2 Query: 494 WDRVASLDLVRLCLGGGFLAV--GAFIKLVRVVIAA--PRQVDALMPR----C-PSQQMG 342 WD VA ++ VR LG G V G++ + + A P +V L+ R C PS+ + Sbjct: 83 WDLVADIEKVREMLGIGKWLVFGGSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETVW 142 Query: 341 LEAAGGVHCIYP 306 L AGGV IYP Sbjct: 143 LNEAGGVSRIYP 154
>PIP_NEIMA (Q9JUV1) Proline iminopeptidase (EC 3.4.11.5) (PIP) (Prolyl| aminopeptidase) (PAP) Length = 310 Score = 30.8 bits (68), Expect = 3.1 Identities = 27/72 (37%), Positives = 37/72 (51%), Gaps = 9/72 (12%) Frame = -2 Query: 494 WDRVASLDLVRLCLGGGFLAV--GAFIKLVRVVIAA--PRQVDALMPR----C-PSQQMG 342 WD VA ++ VR LG G V G++ + + A P +V L+ R C PS+ + Sbjct: 83 WDLVADIEKVREMLGIGKWLVFGGSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETVW 142 Query: 341 LEAAGGVHCIYP 306 L AGGV IYP Sbjct: 143 LNEAGGVSRIYP 154
>RECF_SHIDS (Q329B8) DNA replication and repair protein recF| Length = 357 Score = 30.4 bits (67), Expect = 4.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN + F+ Sbjct: 124 LLNGGPKYRRAFLDWGCFHNESGFF 148
>PIP_NEIGO (P42786) Proline iminopeptidase (EC 3.4.11.5) (PIP) (Prolyl| aminopeptidase) (PAP) Length = 310 Score = 30.0 bits (66), Expect = 5.3 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 9/72 (12%) Frame = -2 Query: 494 WDRVASLDLVRLCLGGGFLAV--GAFIKLVRVVIAA--PRQVDALMPR----C-PSQQMG 342 WD VA ++ VR LG G V G++ + + A P +V L+ R C PS+ Sbjct: 83 WDLVADIEKVREMLGIGKWLVFGGSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETAW 142 Query: 341 LEAAGGVHCIYP 306 L AGGV IYP Sbjct: 143 LNEAGGVSRIYP 154
>RECF_PROMI (P22839) DNA replication and repair protein recF| Length = 362 Score = 29.6 bits (65), Expect = 6.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ + WGC+HN +F+ Sbjct: 127 LLNGGPKYRRAFIDWGCFHNEPRFF 151
>MYS2_DICDI (P08799) Myosin-2 heavy chain, non muscle (Myosin II heavy chain,| non muscle) Length = 2116 Score = 29.6 bits (65), Expect = 6.9 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 321 ALHLSGPRGFSFLHSNGQEDLGG 253 ALHL+GP F++L+ +G D+ G Sbjct: 295 ALHLAGPESFNYLNQSGYVDIKG 317
>RECF_PHOLL (Q7NAD1) DNA replication and repair protein recF| Length = 363 Score = 29.6 bits (65), Expect = 6.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ + WGC+HN +F+ Sbjct: 126 LLNGGPKYRRAFIDWGCFHNEPRFF 150
>VNFA_AZOVI (P12627) Nitrogen fixation protein vnfA| Length = 522 Score = 29.3 bits (64), Expect = 9.0 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -1 Query: 585 WPG*SRRLTIVVE--LYLEKDGSSHGRSLPGSL 493 WPG R L V+E + L +DG HG LP SL Sbjct: 423 WPGNVRELENVIERAMLLSEDGVIHGYHLPPSL 455
>RECF_SHISS (Q3YWB4) DNA replication and repair protein recF| Length = 357 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 124 LLNGGPKYRRAFLDWGCFHNEPGFF 148
>RECF_SHIFL (Q7BZ80) DNA replication and repair protein recF| Length = 357 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 124 LLNGGPKYRRAFLDWGCFHNEPGFF 148
>RECF_SALTY (P24900) DNA replication and repair protein recF| Length = 356 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 123 LLNGGPKYRRAFLDWGCFHNEAGFF 147
>RECF_SALTI (Q8Z2N4) DNA replication and repair protein recF| Length = 356 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 123 LLNGGPKYRRAFLDWGCFHNEAGFF 147
>RECF_SALPA (Q5PKU8) DNA replication and repair protein recF| Length = 357 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 124 LLNGGPKYRRAFLDWGCFHNEAGFF 148
>RECF_SALCH (Q57I02) DNA replication and repair protein recF| Length = 357 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 124 LLNGGPKYRRAFLDWGCFHNEAGFF 148
>RECF_ECOLI (P0A7H0) DNA replication and repair protein recF| Length = 356 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 123 LLNGGPKYRRAFLDWGCFHNEPGFF 147
>RECF_ECOL6 (P0A7H1) DNA replication and repair protein recF| Length = 356 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 123 LLNGGPKYRRAFLDWGCFHNEPGFF 147
>RECF_ECO57 (P0A7H2) DNA replication and repair protein recF| Length = 356 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 123 LLNGGPKYRRAFLDWGCFHNEPGFF 147
>RECF_ERWCT (Q6CYR6) DNA replication and repair protein recF| Length = 361 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 348 LLGRTPRHQSIHLPWGCYHNSNQFY 422 LL P+++ L WGC+HN F+ Sbjct: 124 LLNGGPKYRRAFLDWGCFHNEPGFF 148 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,981,094 Number of Sequences: 219361 Number of extensions: 2232479 Number of successful extensions: 5469 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 5239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5467 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
