Clone Name | rbasd2o08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NLTP_RABIT (O62742) Nonspecific lipid-transfer protein, mitochon... | 32 | 0.57 | 2 | NLTP_HUMAN (P22307) Nonspecific lipid-transfer protein, mitochon... | 30 | 1.3 | 3 | Y178_TREPA (O83208) Hypothetical protein TP0178 | 30 | 1.7 | 4 | NLTP_MOUSE (P32020) Nonspecific lipid-transfer protein, mitochon... | 29 | 2.8 |
---|
>NLTP_RABIT (O62742) Nonspecific lipid-transfer protein, mitochondrial| precursor (EC 2.3.1.176) (Propanoyl-CoA C-acyltransferase) (NSL-TP) (Sterol carrier protein 2) (SCP-2) (Sterol carrier protein X) (SCP-X) (SCP-chi) (SCPX) Length = 547 Score = 31.6 bits (70), Expect = 0.57 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -3 Query: 242 GLSRHPACRNMTRSNKKEQFSKYSLXWQQAXEIXWQGRRH 123 GLS HP M S KE KY + +I W+ +H Sbjct: 152 GLSAHPVAPQMFGSAGKEHMEKYGTKIEHFAKIGWKNHKH 191
>NLTP_HUMAN (P22307) Nonspecific lipid-transfer protein, mitochondrial| precursor (EC 2.3.1.176) (Propanoyl-CoA C-acyltransferase) (NSL-TP) (Sterol carrier protein 2) (SCP-2) (Sterol carrier protein X) (SCP-X) (SCP-chi) (SCPX) Length = 547 Score = 30.4 bits (67), Expect = 1.3 Identities = 20/69 (28%), Positives = 27/69 (39%), Gaps = 3/69 (4%) Frame = -3 Query: 242 GLSRHPACRNMTRSNKKEQFSKYSLXWQQAXEIXWQGRRHWLKLVYFY---RYLVSLVRC 72 GLS HP M KE KY + +I W+ +H + Y Y + V Sbjct: 152 GLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMA 211 Query: 71 SKQRSDLHT 45 SK+ D T Sbjct: 212 SKEVFDFLT 220
>Y178_TREPA (O83208) Hypothetical protein TP0178| Length = 308 Score = 30.0 bits (66), Expect = 1.7 Identities = 19/65 (29%), Positives = 29/65 (44%) Frame = +3 Query: 45 CMQIASLL*TSHQANQIPIKINQLQPMPSALPXDFXCLLPXKRILAELLFFVASCHVATC 224 C Q+ L AN I INQ P+ L + + + +LL V + ++A+C Sbjct: 181 CSQLEFALNNQRMANLFTISINQSALPPAVLQEELSMVRRCCALSNQLLTLVGNDNLASC 240 Query: 225 WVSRE 239 SRE Sbjct: 241 VASRE 245
>NLTP_MOUSE (P32020) Nonspecific lipid-transfer protein, mitochondrial| precursor (EC 2.3.1.176) (Propanoyl-CoA C-acyltransferase) (NSL-TP) (Sterol carrier protein 2) (SCP-2) (Sterol carrier protein X) (SCP-X) (SCP-chi) (SCPX) Length = 547 Score = 29.3 bits (64), Expect = 2.8 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = -3 Query: 242 GLSRHPACRNMTRSNKKEQFSKYSLXWQQAXEIXWQGRRHWLKLVY 105 GLS HP M KE KY + +I W+ +H + Y Sbjct: 152 GLSAHPITPQMFGYAGKEHMEKYGTKVEHFAKIGWKNHKHSVNNTY 197 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,664,947 Number of Sequences: 219361 Number of extensions: 436207 Number of successful extensions: 865 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)