Clone Name | rbasd3c24 |
---|---|
Clone Library Name | barley_pub |
>Y284_METJA (Q57732) Hypothetical protein MJ0284| Length = 219 Score = 37.4 bits (85), Expect = 0.038 Identities = 21/76 (27%), Positives = 41/76 (53%) Frame = -3 Query: 636 KRKGADMEFLSMGLKVASQAVYSLHKTSTREYIKKSALRNCNAISAEVLCELRYDLPRTY 457 ++K AD FL L++ +Y++H T++++ K I+ + E + +P Y Sbjct: 134 QKKHADRVFLDKALEIGD-IIYTIHNYPTKDFVIKYVEDKGGKITH--IYEAFFRIPAIY 190 Query: 456 RFHKQKELDIAVDLWR 409 FHK+K ++I V ++R Sbjct: 191 EFHKKKVVEIPVVIFR 206
>ATRN_MOUSE (Q9WU60) Attractin precursor (Mahogany protein)| Length = 1428 Score = 29.6 bits (65), Expect = 7.9 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -2 Query: 181 NFTAPCQGWLAFSLYQYFL---QCMILFLSCWISGLRKNSVEFKVK 53 NFT P + +AFS + F+ Q + F SC++S L +V +K+K Sbjct: 1258 NFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIK 1303
>ATRN_HUMAN (O75882) Attractin precursor (Mahogany homolog) (DPPT-L)| Length = 1429 Score = 29.6 bits (65), Expect = 7.9 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -2 Query: 181 NFTAPCQGWLAFSLYQYFL---QCMILFLSCWISGLRKNSVEFKVK 53 NFT P + +AFS + F+ Q + F SC++S L +V +K+K Sbjct: 1259 NFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIK 1304
>AMHR2_HUMAN (Q16671) Anti-Muellerian hormone type-2 receptor precursor (EC| 2.7.11.30) (Anti-Muellerian hormone type II receptor) (AMH type II receptor) (MIS type II receptor) (MISRII) (MRII) Length = 573 Score = 29.6 bits (65), Expect = 7.9 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 432 QAPSVCGTCRSVVDRSEAHTELQH*LRCSYARLTS*CILSWKSCVENTLLEMQ 590 +AP V G+ +++ + + TEL +RC Y+R C W + +EMQ Sbjct: 28 EAPGVRGSTKTLGELLDTGTELPRAIRCLYSRC---CFGIWNLTQDRAQVEMQ 77
>PATR_THEFY (Q47KH1) Putative phenylalanine aminotransferase (EC 2.6.1.-)| Length = 359 Score = 29.6 bits (65), Expect = 7.9 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -1 Query: 233 ERQANPGGLAAMPWVAMELYSTLPGLAGV--LSVPVLPSVYDL 111 E A PG W + E Y L GLAG + VP+ +DL Sbjct: 100 EATAEPGAEVVYAWRSFEAYPLLTGLAGATPIHVPLREETHDL 142
>ATRN_RAT (Q99J86) Attractin precursor (Zitter protein)| Length = 1432 Score = 29.6 bits (65), Expect = 7.9 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -2 Query: 181 NFTAPCQGWLAFSLYQYFL---QCMILFLSCWISGLRKNSVEFKVK 53 NFT P + +AFS + F+ Q + F SC++S L +V +K+K Sbjct: 1262 NFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIK 1307 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,089,974 Number of Sequences: 219361 Number of extensions: 2181805 Number of successful extensions: 5226 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5222 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)