Clone Name | rbasd2n16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SC5A5_HUMAN (Q92911) Sodium/iodide cotransporter (Na(+)/I(-) cot... | 29 | 5.6 | 2 | ILVB_SCHPO (P36620) Acetolactate synthase, mitochondrial precurs... | 29 | 7.3 | 3 | RECQ4_MOUSE (Q75NR7) ATP-dependent DNA helicase Q4 (EC 3.6.1.-) ... | 28 | 9.6 |
---|
>SC5A5_HUMAN (Q92911) Sodium/iodide cotransporter (Na(+)/I(-) cotransporter)| (Sodium-iodide symporter) (Na(+)/I(-)-symporter) Length = 643 Score = 29.3 bits (64), Expect = 5.6 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 38 VSSRTHGATSKAEAPSNQNKQAPS--WTSTRSALALHFTAYGYIYY 169 +S G A P+N + +APS ++R ALA F A Y+YY Sbjct: 486 LSVNASGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYY 531
>ILVB_SCHPO (P36620) Acetolactate synthase, mitochondrial precursor (EC| 2.2.1.6) (Acetohydroxy-acid synthase) (ALS) (AHAS) Length = 669 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 91 KQTSSVLDEYSQRTGTAFHSLWIHLLQIWTG*KGRVTA 204 KQTS + D+ + TG H +W WT VT+ Sbjct: 480 KQTSDIKDKVTITTGVGAHQMWAATFYRWTKPSSLVTS 517
>RECQ4_MOUSE (Q75NR7) ATP-dependent DNA helicase Q4 (EC 3.6.1.-) (RecQ| protein-like 4) Length = 1216 Score = 28.5 bits (62), Expect = 9.6 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 64 IQGRGTVESKQTSSVLDEYSQRTGTA 141 +Q G + KQ S L+E +QRTGTA Sbjct: 417 VQEEGDRDDKQPISTLEEVAQRTGTA 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,115,296 Number of Sequences: 219361 Number of extensions: 1220008 Number of successful extensions: 2745 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2742 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)