| Clone Name | rbasd2n05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU2M_MUNMN (Q85PS1) NADH-ubiquinone oxidoreductase chain 2 (EC 1... | 30 | 6.4 | 2 | NU2M_POTFL (Q2TGY5) NADH-ubiquinone oxidoreductase chain 2 (EC 1... | 30 | 8.3 | 3 | VASS_BPGA (P07394) Assembly protein (Maturation protein) (A prot... | 30 | 8.3 |
|---|
>NU2M_MUNMN (Q85PS1) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 347 Score = 30.0 bits (66), Expect = 6.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 48 LALQVCTRMLTFIVYHYRTTTTPLCLIYWWNEVP 149 L + + TF+++ Y +TTT L L WN+ P Sbjct: 205 LTIYIIMTTTTFMLFMYNSTTTTLSLSQTWNKAP 238
>NU2M_POTFL (Q2TGY5) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 347 Score = 29.6 bits (65), Expect = 8.3 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 39 TAALALQVCTRMLTFIVYHYRTTTTPLCLIYWWNEVP 149 T L + + + TF+++ Y ++TT L L + WN+ P Sbjct: 202 TLNLMMYIVMTLSTFMLFMYSSSTTTLSLSHAWNKFP 238
>VASS_BPGA (P07394) Assembly protein (Maturation protein) (A protein)| Length = 390 Score = 29.6 bits (65), Expect = 8.3 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 8/72 (11%) Frame = -1 Query: 296 RVTYRLSSRVRLPVLANLGT*RSDGGRHN-KTSNICQDKNIDISWSYR-------TTWHF 141 + Y L ++ +LP L R+ GG HN K N+ ++ +WSYR W+F Sbjct: 210 KAAYDLLTQTKLPAFMPLRVTRTVGGTHNYKVRNV---ESAGDTWSYRHRLSVNYRIWYF 266 Query: 140 IPPVDQA*WCSS 105 I A W SS Sbjct: 267 ISDPRLA-WASS 277 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,454,227 Number of Sequences: 219361 Number of extensions: 2068129 Number of successful extensions: 4844 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4843 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)