Clone Name | rbasd3b23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-as... | 29 | 3.3 | 2 | CILP1_PIG (O19112) Cartilage intermediate layer protein 1 (CILP-... | 28 | 4.3 | 3 | UNG_FOWPV (P21968) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG) | 27 | 9.5 |
---|
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 28.9 bits (63), Expect = 3.3 Identities = 18/56 (32%), Positives = 23/56 (41%) Frame = -1 Query: 171 CCYSMCDDVSPHLPPCHQE*ALHSSYKAFEDLVLHCTVPHCNMAVGCRVVPFNKSS 4 CC S+C S PC Q+ + S+ F C VP C + C V SS Sbjct: 133 CCVSICSGASS---PCCQQSSCQSACCTFSPCQQACCVPICCKPICCVPVCSGASS 185
>CILP1_PIG (O19112) Cartilage intermediate layer protein 1 (CILP-1) [Contains:| Cartilage intermediate layer protein 1 C2] (Fragment) Length = 599 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 297 NPIDQRVRRHSAAGLLQSTITLPNHASTVLNNGP 196 N ++++V R SA LQST P+ ASTV P Sbjct: 534 NCVERQVGRQSAFQYLQSTSARPSPASTVRGRAP 567
>UNG_FOWPV (P21968) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 218 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -2 Query: 185 YSMLLAAIVCVTMYHLTCRHAIKNEHCIAHTRLSRILFSTV-LYLTVIWLLG 33 Y+ L V Y+L+CR H I RL+ + + + Y++V + LG Sbjct: 108 YNFLFVEGVLAWNYYLSCREGETKSHKIFWERLADVFINHIAAYVSVFYFLG 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,486,811 Number of Sequences: 219361 Number of extensions: 918492 Number of successful extensions: 2212 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2212 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)