Clone Name | rbasd3b16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FGD5_HUMAN (Q6ZNL6) FYVE, RhoGEF and PH domain-containing protei... | 29 | 7.9 |
---|
>FGD5_HUMAN (Q6ZNL6) FYVE, RhoGEF and PH domain-containing protein 5 (Zinc finger| FYVE domain-containing protein 23) Length = 1462 Score = 29.3 bits (64), Expect = 7.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 260 LSHKMVCCNCRVSGRLYLRVFHCPSGPSIIC 168 ++H M+C NC L LR HC + I+C Sbjct: 1242 VTHVMMCMNCGCDFSLTLRRHHCHACGKIVC 1272 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,200,891 Number of Sequences: 219361 Number of extensions: 812796 Number of successful extensions: 2300 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2289 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)