Clone Name | rbasd3b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PIGT_MOUSE (Q8BXQ2) GPI transamidase component PIG-T precursor (... | 30 | 2.5 | 2 | MT21_ORYSA (P94029) Metallothionein-like protein type 2 | 30 | 3.2 | 3 | SMG7_MOUSE (Q5RJH6) Protein SMG7 (SMG-7 homolog) (EST1-like prot... | 28 | 9.4 |
---|
>PIGT_MOUSE (Q8BXQ2) GPI transamidase component PIG-T precursor| (Phosphatidylinositol-glycan biosynthesis, class T protein) (Neuronal development-associated protein 7) Length = 582 Score = 30.4 bits (67), Expect = 2.5 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 7 LHTQEYIYVDKTGKAHEDGTKAVGEAHDNTTQNTVQATRGTY 132 L +Q +YVD TG + ++ T V +T Q+ + TR TY Sbjct: 278 LASQSLVYVDITGYSQDNETLEVSPPPTSTYQDVILGTRKTY 319
>MT21_ORYSA (P94029) Metallothionein-like protein type 2| Length = 82 Score = 30.0 bits (66), Expect = 3.2 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 452 TSSQALVMGVASSKGNGPSFEAAAA 378 T++Q ++MGVA SKG+ EA AA Sbjct: 34 TTTQTVIMGVAPSKGHAEGLEAGAA 58
>SMG7_MOUSE (Q5RJH6) Protein SMG7 (SMG-7 homolog) (EST1-like protein C)| Length = 1138 Score = 28.5 bits (62), Expect = 9.4 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 286 SMPSPCVDSTDHLQVHGLQVQLGPHLHPPFSAAAASNEGPL 408 S+P + ST H G QVQ G H P+S S GP+ Sbjct: 641 SVPGTFLQSTAHSPA-GNQVQAGKQSHIPYSQQRPSGPGPM 680 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,452,500 Number of Sequences: 219361 Number of extensions: 1091028 Number of successful extensions: 3072 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3071 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)